• Catalog number
    C082-1000
  • Product name
    Recombinant Rabbit Tumor Necrosis Factor a/TNF-a
  • Size
    1 mg
  • Description
    Recombinant Rabbit Tumor Necrosis Factor alpha is produced by our E.coli expression system and the target gene encoding Val77-Leu235 is expressed.
  • Species reactivity
    Rabbit
  • Origin
    Escherichia coli
  • Peptide sequence
    MVTLRSASRALSDKPLAHVVANPQVEGQLQWLSQRANALLANGMKLTDNQLVVPADGLYLIYSQVLFSGQGCRSYVLLTHTVSRFAVSYPNKVNLLSAIKSPCHRETPEEAEPMAWYEPIYLGGVFQLEKGDRLSTEVNQPEYLDLAESGQVYFGIIAL
  • Estimated molecular weight
    17,59 kDa
  • Protein purity
    Greater than 95% as determined by reducing SDS-PAGE.
  • Endotoxin level
    Less than 0.1 ng/µg (1 IEU/µg) as determined by LAL test.
  • Shipping condition
    Ambient/Room Temperature
  • Package form
    Lyophilized from a 0.2 µm filtered solution of 20mM PB, 300mM NaCl, pH7.4.
  • Storage conditions
    Lyophilized protein should be stored at below -20°C, though stable at room temperature for 3 weeks.Reconstituted protein solution can be stored at 4-7°C for 2-7 days.Aliquots of reconstituted samples are stable at below -20°C for 3 months.
  • Reconstitution conditions
    Always centrifuge tubes before opening. Do not mix by vortex or pipetting.It is not recommended to reconstitute to a concentration less than 100 µg/ml.Dissolve the lyophilized protein in ddH2O.Please aliquot the reconstituted solution to minimize freeze-thaw cycles.
  • UniProt number
    P04924
  • Other related products
  • Alternative to gene target
    • [ "tumor necrosis factor", "DIF and TNF-alpha and TNFA and TNFSF2", "TNF and IDBG-300259 and ENSG00000232810 and 7124", "transcription regulatory region DNA binding", "Extracellular", "Tnf and IDBG-177358 and ENSMUSG00000024401 and 21926", "TNF and IDBG-634161 and ENSBTAG00000025471 and 280943" ]
  • Gene target
    Tumor Necrosis Factor a/TNF-a
  • Gene info
    Gene info
    Gene info
    Gene info
  • Gene symbol
    TNF, TNFRSF1A, TNFRSF1B, LTBR
  • Host
    Rabbit, Rabbits
  • Short name
    Recombinant Rabbit Tumor Necrosis Factor a/TNF-a
  • technique filter
    • Recombinant
    • Rabbit
  • Technique
    Recombinant, Rabbit, E. coli recombinant proteins are genetic recombinations in Escherichia coli, supplied as white sterile powder lyopillized. novo advises they will be reconstituted in a buffer soluion or culture medium for cell culture.
  • Alternative technique
    rec, rabbit-anti
  • Tissue
    tumor
  • tissue filter
    • tumor