• Catalog number
    CI37-1000
  • Product name
    Recombinant Mouse Placenta Growth Factor/PGF/PIGF (C-6His)
  • Size
    1 mg
  • Description
    Recombinant Mouse Placenta growth factor is produced by our Mammalian expression system and the target gene encoding Val19-Pro158 is expressed with a 6His tag at the C-terminus.
  • Species reactivity
    Mouse
  • Origin
    Human Cells
  • Peptide sequence
    VHSQGALSAGNNSTEVEVVPFNEVWGRSYCRPMEKLVYILDEYPDEVSHIFSPSCVLLSRCSGCCGDEGLHCVPIKTANITMQILKIPPNRDPHFYVEMTFSQDVLCECRPILETTKAERRKTKGKRKRSRNSQTEEPHPVDHHHHHH
  • Estimated molecular weight
    16,9 kDa
  • Protein purity
    Greater than 95% as determined by reducing SDS-PAGE.
  • Endotoxin level
    Less than 0.1 ng/µg (1 IEU/µg) as determined by LAL test.
  • Shipping condition
    Ambient/Room Temperature
  • Package form
    Lyophilized from a 0.2 µm filtered solution of 20mM PB,150mM NaCl,pH7.4.
  • Storage conditions
    Lyophilized protein should be stored at below -20°C, though stable at room temperature for 3 weeks.Reconstituted protein solution can be stored at 4-7°C for 2-7 days.Aliquots of reconstituted samples are stable at below -20°C for 3 months.
  • Reconstitution conditions
    Always centrifuge tubes before opening. Do not mix by vortex or pipetting.It is not recommended to reconstitute to a concentration less than 100 µg/ml.Dissolve the lyophilized protein in ddH2O.Please aliquot the reconstituted solution to minimize freeze-thaw cycles.
  • UniProt number
    P49764
  • Other related products
  • Gene target
    Placenta Growth Factor/PGF/PIGF C-6His
  • Gene info
    Gene info
  • Gene symbol
    PIGF, PGF
  • Host
    mouse
  • Short name
    Recombinant Mouse Placenta Growth Factor/PGF/PIGF (C-6His)
  • technique filter
    • Recombinant
    • Mouse
  • Technique
    Recombinant, Mouse, mouses, E. coli recombinant proteins are genetic recombinations in Escherichia coli, supplied as white sterile powder lyopillized. novo advises they will be reconstituted in a buffer soluion or culture medium for cell culture.
  • Alternative technique
    rec, murine
  • Tissue
    placenta
  • tissue filter
    • placenta