• Catalog number
    C044-1000
  • Product name
    Recombinant Mouse Fibroblast Growth Factor 2/FGF-2/FGFb (Met1-Ser154)
  • Size
    1 mg
  • Description
    Recombinant Mouse Fibroblast growth factor 2 is produced by our E.coli expression system and the target gene encoding Met1-Ser154 is expressed.
  • Species reactivity
    Mouse
  • Origin
    Escherichia coli
  • Peptide sequence
    MAASGITSLPALPEDGGAAFPPGHFKDPKRLYCKNGGFFLRIHPDGRVDGVREKSDPHVKLQLQAEERGVVSIKGVCANRYLAMKEDGRLLASKCVTEECFFFERLESNNYNTYRSRKYSSWYVALKRTGQYKLGSKTGPGQKAILFLPMSAKS
  • Estimated molecular weight
    17,15 kDa
  • Protein purity
    Greater than 95% as determined by reducing SDS-PAGE.
  • Endotoxin level
    Less than 0.1 ng/µg (1 IEU/µg) as determined by LAL test.
  • Shipping condition
    Ambient/Room Temperature
  • Package form
    Lyophilized from a 0.2 µm filtered solution of 20mM PB, 400mM NaCl, pH 7.0.
  • Storage conditions
    Lyophilized protein should be stored at below -20°C, though stable at room temperature for 3 weeks.Reconstituted protein solution can be stored at 4-7°C for 2-7 days.Aliquots of reconstituted samples are stable at below -20°C for 3 months.
  • Reconstitution conditions
    See included datasheet or contact us for more information.
  • UniProt number
    P15655
  • Other related products
  • Gene target
    Fibroblast Growth Factor 2/FGF-2/FGFb Met1-Ser154
  • Gene info
    Gene info
    Gene info
    Gene info
    Gene info
    Gene info
    Gene info
    Gene info
    Gene info
    Gene info
  • Gene symbol
    FGF2, FGF18, FGF17, FGF13, NUDT6, MIR1289-2, MIR521-2, MIR509-2, MIR512-2, MIR7-2
  • Host
    mouse
  • Short name
    Recombinant Mouse Fibroblast Growth Factor 2/FGF-2/FGFb (Met1-Ser154)
  • technique filter
    • Recombinant
    • Mouse
  • Technique
    Recombinant, Mouse, mouses, E. coli recombinant proteins are genetic recombinations in Escherichia coli, supplied as white sterile powder lyopillized. novo advises they will be reconstituted in a buffer soluion or culture medium for cell culture.
  • Alternative technique
    rec, murine