gentaur logogentaur logo
x

Recombinant Human V-Set and Ig Domain-Containing Protein 4/VSIG4/CRIg (C-6His)

  • Catalog number
    C549-50
  • Product name
    Recombinant Human V-Set and Ig Domain-Containing Protein 4/VSIG4/CRIg (C-6His)
  • Size
    50 ug
  • Description
    Recombinant Human VSIG4 is produced by our Mammalian expression system and the target gene encoding Arg20-Pro283 is expressed with a 6His tag at the C-terminus.
  • Species reactivity
    Human
  • Origin
    Human cells
  • Peptide sequence
    RPILEVPESVTGPWKGDVNLPCTYDPLQGYTQVLVKWLVQRGSDPVTIFLRDSSGDHIQQAKYQGRLHVSHKVPGDVSLQLSTLEMDDRSHYTCEVTWQTPDGNQVVRDKITELRVQKLSVSKPTVTTGSGYGFTVPQGMRISLQCQARGSPPISYIWYKQQTNNQEPIKVATLSTLLFKPAVIADSGSYFCTAKGQVGSEQHSDIVKFVVKDSSKLLKTKTEAPTTMTYPLKATSTVKQSWDWTTDMDGYLGETSAGPGKSLPVDHHHHHH
  • Estimated molecular weight
    30,2 kDa
  • Protein purity
    Greater than 95% as determined by reducing SDS-PAGE.
  • Endotoxin level
    Less than 0.1 ng/µg (1 IEU/µg) as determined by LAL test.
  • Shipping condition
    Ambient/Room Temperature
  • Package form
    Lyophilized from a 0.2 µm filtered solution of 20mM PB, 150mM NaCl, pH 7.2.
  • Storage conditions
    Lyophilized protein should be stored at below -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at below -20°C for 3 months.
  • Reconstitution conditions
    Always centrifuge tubes before opening. Do not mix by vortex or pipetting.It is not recommended to reconstitute to a concentration less than 100 µg/ml.Dissolve the lyophilized protein in ddH2O.Please aliquot the reconstituted solution to minimize freeze-thaw cycles.
  • UniProt number
    Q9Y279
  • Other related products
    Other_related_products
  • Alternative to gene target
    • [ "V-set and immunoglobulin domain containing 4", "CRIg and Z39IG", "VSIG4 and IDBG-73541 and ENSG00000155659 and 11326", "protein binding", "Plasma membranes", "Vsig4 and IDBG-160903 and ENSMUSG00000044206 and 278180", "VSIG4 and IDBG-637672 and ENSBTAG00000015769 and 614262" ]
  • Gene target
    V-Set Ig Domain Protein 4/VSIG4/CRIg C-6His
    • Gene info
    Locus Specific Databases:Global Variome shared LOVD
  • Gene symbol
    VSIG4
  • Short name
    Recombinant V-Set Ig Domain- Protein 4/VSIG4/CRIg (C-6His)
  • technique filter
    • Recombinant
  • Technique
    Recombinant, E. coli recombinant proteins are genetic recombinations in Escherichia coli, supplied as white sterile powder lyopillized. novo advises they will be reconstituted in a buffer soluion or culture medium for cell culture.
  • Alternative technique
    rec
  • Tissue
    set
  • tissue filter
    • set