gentaur logogentaur logo
x

Recombinant Human Tryptase epsilon/Brain-Specific Serine Protease 4/BSSP-4 (C-6His)

  • Catalog number
    C383-10
  • Product name
    Recombinant Human Tryptase epsilon/Brain-Specific Serine Protease 4/BSSP-4 (C-6His)
  • Size
    10 ug
  • Description
    Recombinant Human Tryptase epsilon is produced by our Mammalian expression system and the target gene encoding Ala33-Ser317 is expressed with a 6His tag at the C-terminus.
  • Species reactivity
    Human
  • Origin
    Human cells
  • Peptide sequence
    ARIPVPPACGKPQQLNRVVGGEDSTDSEWPWIVSIQKNGTHHCAGSLLTSRWVITAAHCFKDNLNKPYLFSVLLGAWQLGNPGSRSQKVGVAWVEPHPVYSWKEGACADIALVRLERSIQFSERVLPICLPDASIHLPPNTHCWISGWGSIQDGVPLPHPQTLQKLKVPIIDSEVCSHLYWRGAGQGPITEDMLCAGYLEGERDACLGDSGGPLMCQVDGAWLLAGIISWGEGCAERNRPGVYISLSAHRSWVEKIVQGVQLRGRAQGGGALRAPSQGSGAAARSHHHHHH
  • Estimated molecular weight
    31,56 kDa
  • Protein purity
    Greater than 95% as determined by reducing SDS-PAGE.
  • Endotoxin level
    Less than 0.1 ng/µg (1 IEU/µg) as determined by LAL test.
  • Shipping condition
    Dry ice/ice packs
  • Package form
    Supplied as a 0.2 µm filtered solution of 20mM HAc-NaAc, 150mM NaCl, 10% Glycerol, pH 4.5.
  • Storage conditions
    Store at below -20°C, stable for 6 months after receipt. Please minimize freeze-thaw cycles.
  • Reconstitution conditions
    Always centrifuge tubes before opening. Do not mix by vortex or pipetting.It is not recommended to reconstitute to a concentration less than 100 µg/ml.Dissolve the lyophilized protein in ddH2O.Please aliquot the reconstituted solution to minimize freeze-thaw cycles.
  • UniProt number
    Q9GZN4
  • Other related products
    Other_related_products
  • Gene target
    Tryptase epsilon/Brain-Specific Serine Protease 4/BSSP-4 C-6His
    • Gene info
    Gene info
    Gene info
    Gene info
    Gene info
    • Identity:HGNC:37522
    • Gene:PIRC18
    • Long gene name:piwi-interacting RNA cluster 18
    • Discovery year:2009-11-05
    • Entrez gene record:100313906
    • Pubmed identification:17881367
    • Classification:Piwi-interacting RNA clusters
    Gene info
    • Identity:HGNC:37520
    • Gene:PIRC16
    • Long gene name:piwi-interacting RNA cluster 16
    • Discovery year:2009-11-05
    • Entrez gene record:100313849
    • Pubmed identification:17881367
    • Classification:Piwi-interacting RNA clusters
    Gene info
    Gene info
  • Gene symbol
    PRSS22, PRSS12, KLK6, MIR1302-4, PIRC18, PIRC16, SNORD114-4, IGKV2OR2-4
  • Short name
    Recombinant Tryptase epsilon/Brain-Specific Serine Protease 4/BSSP-4 (C-6His)
  • technique filter
    • Recombinant
  • Technique
    Recombinant, E. coli recombinant proteins are genetic recombinations in Escherichia coli, supplied as white sterile powder lyopillized. novo advises they will be reconstituted in a buffer soluion or culture medium for cell culture.
  • Alternative technique
    rec
  • Tissue
    brain
  • tissue filter
    • brain