gentaur logogentaur logo
x

Recombinant Human Noggin/NOG (N-8His-Flag)

  • Catalog number
    C018-50
  • Product name
    Recombinant Human Noggin/NOG (N-8His-Flag)
  • Size
    50 ug
  • Description
    Recombinant Human Noggin is produced by our Mammalian expression system and the target gene encoding Gln28-Cys232 is expressed with a 8His-Flag tag at the N-terminus.
  • Species reactivity
    Human
  • Origin
    Human cells
  • Peptide sequence
    HHHHHHHHDYKDDDDKQHYLHIRPAPSDNLPLVDLIEHPDPIFDPKEKDLNETLLRSLLGGHYDPGFMATSPPEDRPGGGGGAAGGAEDLAELDQLLRQRPSGAMPSEIKGLEFSEGLAQGKKQRLSKKLRRKLQMWLWSQTFCPVLYAWNDLGSRFWPRYVKVGSCFSKRSCSVPEGMVCKPSKSVHLTVLRWRCQRRGGQRCGWIPIQYPIISECKCSC
  • Estimated molecular weight
    25,2 kDa
  • Protein purity
    Greater than 95% as determined by reducing SDS-PAGE.
  • Endotoxin level
    Less than 0.1 ng/µg (1 IEU/µg) as determined by LAL test.
  • Shipping condition
    Ambient/Room Temperature
  • Package form
    Lyophilized from a 0.2 µm filtered solution of 20mM PB,500mM NaCl,2mM EDTA,pH7.4.
  • Storage conditions
    Lyophilized protein should be stored at below -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at below -20°C for 3 months.
  • Reconstitution conditions
    See included datasheet or contact us for more information.
  • UniProt number
    Q13253
  • Other related products
    Other_related_products
  • Alternative to gene target
    • [ "noggin", "SYM1 and SYNS1", "NOG and IDBG-60160 and ENSG00000183691 and 9241", "protein homodimerization activity", "Extracellular", "Nog and IDBG-208239 and ENSMUSG00000048616 and 18121", "NOG and IDBG-647068 and ENSBTAG00000040282 and 538769" ]
  • Gene target
    Noggin/NOG N-8His
    • Gene info
  • Gene symbol
    NOG
  • Short name
    Recombinant Noggin/NOG (N-8His- )
  • Label
    Flag
  • label filter
    • Flag
  • technique filter
    • Recombinant
  • Technique
    Recombinant, E. coli recombinant proteins are genetic recombinations in Escherichia coli, supplied as white sterile powder lyopillized. novo advises they will be reconstituted in a buffer soluion or culture medium for cell culture.
  • Alternative technique
    rec