- Catalog numberCS55-1000
- Product nameRecombinant Human NKG2A & CD94 Heterodimer (N-8His & N-Flag)
- Size1 mg
- PriceAsk For Price
- DescriptionRecombinant Human Human NKG2A & CD94 Heterodimer is produced by our Mammalian expression system and the target gene encoding Arg100-Leu233 & Ser34-Ile179 is expressedwith a 8His & Flag tag at the N-terminus
- Species reactivityHuman
- OriginHuman cells
- Peptide sequenceHHHHHHHHRHNNSSLNTRTQKARHCGHCPEEWITYSNSCYYIGKERRTWEESLLACTSKNSSLLSIDNEEEMKFLSIISPSSWIGVFRNSSHHPWVTMNGLAFKHEIKDSDNAELNCAVLQVNRLKSAQCGSSIIYHCKHKL&DYKDDDDKSFTKLSIEPAFTPGPNIELQKDSDCCSCQEKWVGYRCNCYFISSEQKTWNESRHLCASQKSSLLQLQNTDELDFMSSSQQFYWIGLSYSEEHTAWLWENGSALSQYLFPSFETFNTKNCIAYNPNGNALDESCEDKNRYICKQQLI
- Estimated molecular weight34,4 kDa
- Protein purityGreater than 95% as determined by reducing SDS-PAGE.
- Endotoxin levelLess than 0.1 ng/µg (1 IEU/µg) as determined by LAL test.
- Shipping conditionAmbient/Room Temperature
- Package formLyophilized from a 0.2 µm filtered solution of PBS, pH7.4.
- Storage conditionsLyophilized protein should be stored at below -20°C, though stable at room temperature for 3 weeks.Reconstituted protein solution can be stored at 4-7°C for 2-7 days.Aliquots of reconstituted samples are stable at below -20°C for 3 months.
- Reconstitution conditionsSee included datasheet or contact us for more information.
- UniProt numberP26715&Q13241
- Other related products
- Gene targetNKG2A CD94 Heterodimer N-8His N
- Identity:HGNC:6378
- Gene:KLRD1
- Long gene name:killer cell lectin like receptor D1
- Synonyms gene name:killer cell lectin-like receptor subfamily D, member 1
- Discovery year:1998-01-16
- Entrez gene record:3824
- Pubmed identification:7589107
- RefSeq identity:NM_002262
- Classification:Killer cell lectin like receptors, C-type lectin domain containing, CD molecules
- VEGA ID:OTTHUMG00000168419
- Gene symbolKLRD1
- Short nameRecombinant NKG2A & CD94 Heterodimer (N-8His & N- )
- LabelFlag
- label filter
- Flag
- technique filter
- Recombinant
- TechniqueRecombinant, E. coli recombinant proteins are genetic recombinations in Escherichia coli, supplied as white sterile powder lyopillized. novo advises they will be reconstituted in a buffer soluion or culture medium for cell culture.
- Alternative techniquerec