• Catalog number
    CE91-500
  • Product name
    Recombinant Human DNA Fragmentation Factor Subunit a/DFFA/DFF45/ICAD (N-6His)
  • Size
    500 ug
  • Description
    Recombinant Human DFF45 is produced by our E.coli expression system and the target gene encoding Met1-Thr331 is expressed with a 6His tag at the N-terminus.
  • Species reactivity
    Human
  • Origin
    Escherichia coli
  • Peptide sequence
    MGSSHHHHHHSSGLVPRGSHMEVTGDAGVPESGEIRTLKPCLLRRNYSREQHGVAASCLEDLRSKACDILAIDKSLTPVTLVLAEDGTIVDDDDYFLCLPSNTKFVALASNEKWAYNNSDGGTAWISQESFDVDETDSGAGLKWKNVARQLKEDLSSIILLSEEDLQMLVDAPCSDLAQELRQSCATVQRLQHTLQQVLDQREEVRQSKQLLQLYLQALEKEGSLLSKQEESKAAFGEEVDAVDTGISRETSSDVALASHILTALREKQAPELSLSSQDLELVTKEDPKALAVALNWDIKKTETVQEACEWELALRLQQTQSLHSLRSISASKASPPGDLQNPKRARQDPT
  • Estimated molecular weight
    38,7 kDa
  • Protein purity
    Greater than 95% as determined by reducing SDS-PAGE.
  • Endotoxin level
    Less than 0.1 ng/µg (1 IEU/µg) as determined by LAL test.
  • Shipping condition
    Dry Ice/ice packs
  • Package form
    Supplied as a 0.2 µm filtered solution of 20mM PB,150mM NaCl,pH7.4.
  • Storage conditions
    Store at below -20°C, stable for 6 months after receipt. Please minimize freeze-thaw cycles.
  • Reconstitution conditions
    Always centrifuge tubes before opening. Do not mix by vortex or pipetting.It is not recommended to reconstitute to a concentration less than 100 µg/ml.Dissolve the lyophilized protein in ddH2O.Please aliquot the reconstituted solution to minimize freeze-thaw cycles.
  • UniProt number
    O00273
  • Other related products
  • Alternative to gene target
    • [ "DNA fragmentation factor, 45kDa, alpha polypeptide", "DFF-45 and DFF1 and ICAD", "DFFA and IDBG-89047 and ENSG00000160049 and 1676", "protein binding", "nuclei", "Dffa and IDBG-204894 and ENSMUSG00000028974 and 13347" ]
  • Gene target
    DNA Fragmentation Factor Subunit a/DFFA/DFF45/ICAD N-6His
  • Gene info
    Gene info
    Gene info
  • Gene symbol
    DFFA, PRKDC, HLA-DOA
  • Short name
    Recombinant DNA Fragmentation Factor Subunit a/DFFA/DFF45/ICAD (N-6His)
  • technique filter
    • Recombinant
    • dna
  • Technique
    Recombinant, dna, E. coli recombinant proteins are genetic recombinations in Escherichia coli, supplied as white sterile powder lyopillized. novo advises they will be reconstituted in a buffer soluion or culture medium for cell culture.
  • Alternative technique
    rec