gentaur logogentaur logo
x

Recombinant Human Bone Marrow Stromal Antigen 2/BST2/Tetherin/CD317 (C-6His)

  • Catalog number
    CA75-500
  • Product name
    Recombinant Human Bone Marrow Stromal Antigen 2/BST2/Tetherin/CD317 (C-6His)
  • Size
    500 ug
  • Description
    Recombinant Human Bone Marrow Stromal Antigen 2 is produced by our Mammalian expression system and the target gene encoding Asn49-Ser161 is expressed with a 6His tag at the C-terminus.
  • Species reactivity
    Human
  • Origin
    Human cells
  • Peptide sequence
    NSEACRDGLRAVMECRNVTHLLQQELTEAQKGFQDVEAQAATCNHTVMALMASLDAEKAQGQKKVEELEGEITTLNHKLQDASAEVERLRRENQVLSVRIADKKYYPSSQDSSVDHHHHHH
  • Estimated molecular weight
    13,67 kDa
  • Protein purity
    Greater than 95% as determined by reducing SDS-PAGE.
  • Endotoxin level
    Less than 0.1 ng/µg (1 IEU/µg) as determined by LAL test.
  • Shipping condition
    Ambient/Room Temperature
  • Package form
    Lyophilized from a 0.2 µm filtered solution of 20mM PB,150mM NaCl,pH7.4.
  • Storage conditions
    Lyophilized protein should be stored at below -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at below -20°C for 3 months.
  • Reconstitution conditions
    Always centrifuge tubes before opening. Do not mix by vortex or pipetting.It is not recommended to reconstitute to a concentration less than 100 µg/ml.Dissolve the lyophilized protein in ddH2O.Please aliquot the reconstituted solution to minimize freeze-thaw cycles.
  • UniProt number
    Q10589
  • Other related products
    Other_related_products
  • Alternative to gene target
    • [ "bone marrow stromal cell antigen 2", "CD317 and TETHERIN", "BST2 and IDBG-36619 and ENSG00000130303 and 684", "poly(A) RNA binding", "Cell surfaces", "Bst2 and IDBG-165924 and ENSMUSG00000046718 and 69550" ]
  • Gene target
    Bone Marrow Stromal 2/BST2/Tetherin/CD317 C-6His
    • Gene info
  • Gene symbol
    BST2
  • Short name
    Recombinant Bone Marrow Stromal Antigen 2/BST2/Tetherin/CD317 (C-6His)
  • technique filter
    • Recombinant
    • antigen
  • Technique
    Recombinant, antigen, antigenes, E. coli recombinant proteins are genetic recombinations in Escherichia coli, supplied as white sterile powder lyopillized. novo advises they will be reconstituted in a buffer soluion or culture medium for cell culture.
  • Alternative technique
    rec, antigenes
  • Tissue
    bone, marrow
  • tissue filter
    • bone
    • marrow