gentaur logogentaur logo
x

Recombinant Human B- and T-Lymphocyte Attenuator/BTLA/CD272 (C-6His)

  • Catalog number
    C563-1000
  • Product name
    Recombinant Human B- and T-Lymphocyte Attenuator/BTLA/CD272 (C-6His)
  • Size
    1 mg
  • Description
    Recombinant Human BTLA is produced by our Mammalian expression system and the target gene encoding Lys31-Leu150 is expressed with a 6His tag at the C-terminus.
  • Species reactivity
    Human
  • Origin
    Human Cells
  • Peptide sequence
    KESCDVQLYIKRQSEHSILAGDPFELECPVKYCANRPHVTWCKLNGTTCVKLEDRQTSWKEEKNISFFILHFEPVLPNDNGSYRCSANFQSNLIESHSTTLYVTGKQNELSDTAGREINLVDHHHHHH
  • Estimated molecular weight
    14,79 kDa
  • Protein purity
    Greater than 95% as determined by reducing SDS-PAGE.
  • Endotoxin level
    Less than 0.1 ng/µg (1 IEU/µg) as determined by LAL test.
  • Shipping condition
    Ambient/Room Temperature
  • Package form
    Lyophilized from a 0.2 µm filtered solution of 20mM PB, 150mM NaCl, pH 7.4.
  • Storage conditions
    Lyophilized protein should be stored at below -20°C, though stable at room temperature for 3 weeks.Reconstituted protein solution can be stored at 4-7°C for 2-7 days.Aliquots of reconstituted samples are stable at below -20°C for 3 months.
  • Reconstitution conditions
    Always centrifuge tubes before opening. Do not mix by vortex or pipetting.It is not recommended to reconstitute to a concentration less than 100 µg/ml.Dissolve the lyophilized protein in ddH2O.Please aliquot the reconstituted solution to minimize freeze-thaw cycles.
  • UniProt number
    Q7Z6A9
  • Other related products
    Other_related_products
  • Alternative to gene target
    • [ "B and T lymphocyte associated", "BTLA and IDBG-49858 and ENSG00000186265 and 151888", "protein binding", "Cell surfaces", "Btla and IDBG-162900 and ENSMUSG00000052013 and 208154", "BTLA and IDBG-632288 and ENSBTAG00000011871 and 531767" ]
  • Gene target
    B T-Lymphocyte Attenuator/BTLA/CD272 C-6His
    • Gene info
  • Gene symbol
    BTLA
  • Short name
    Recombinant B- T-Lymphocyte Attenuator/BTLA/CD272 (C-6His)
  • technique filter
    • Recombinant
  • Technique
    Recombinant, E. coli recombinant proteins are genetic recombinations in Escherichia coli, supplied as white sterile powder lyopillized. novo advises they will be reconstituted in a buffer soluion or culture medium for cell culture.
  • Alternative technique
    rec
  • Tissue
    lymphocyte
  • tissue filter
    • lymphocyte