STMN1 Antibody / Stathmin 1

• Catalog number
  R31986
• Price
  Please ask
• Size
  0.1mg

• Category
  Antibody
• Concentration
  0.5mg/ml if reconstituted with 0.2ml sterile DI water
• Form
  Antigen affinity purified
• Conjugation
  Unconjugated
• Clone
  Polyclonal antibody
• Recognised antigen
  STMN1 / Stathmin 1
• Host animal
  Rabbit (Oryctolagus cuniculus)
• Clonality
  Polyclonal (rabbit origin)
• Species reactivity
  Human (Homo sapiens), Mouse (Mus musculus), Rat ; Due to limited knowledge and inability to test the antibody against all known species, we cannot guarantee that no other cross reactivity can occur.
• Tested applications
  WB, IHC-P
• Recommended dilutions
  Western blot: 0.1-0.5ug/ml,IHC (Paraffin): 0.5-1ug/ml
• Notes
  Optimal dilution of the Stathmin 1 antibody should be determined by the researcher.
• Intented use
  This Stathmin 1 antibodyis to be used only for research purposes and not for diagnostics..
• Uniprot
  P16949
• Purity
  Antigen affinity
• Description
  Stathmin 1/oncoprotein 18, also known as STMN1, is a highly conserved 17 kDa protein. This gene belongs to the stathmin family of genes. It encodes a ubiquitous cytosolic phosphoprotein proposed to function as an intracellular relay integrating regulatory signals of the cellular environment. The encoded protein is involved in the regulation of the microtubule filament system by destabilizing microtubules. It prevents assembly and promotes disassembly of microtubules. Multiple transcript variants encoding different isoforms have been found for this gene.
• Immunogen
  Amino acids ASSDIQVKELEKRASGQAFELILSPRSKESVPE of human STMN1 were used as the immunogen for the Stathmin 1 antibody.
• Storage
  After reconstitution, the Stathmin 1 antibody may be kept for up to one month refrigerated at +4 degrees C.For long-term, aliquot and store at -20 deg. Celcius or lower. Cycles of freezing and thawing can denaturate the peptide chains of the antibodies and reduce their sensitivity and/or change their affinity. Prepare aliqotes in such a manner so that freeze-thaw cycles are minimized. Avoid repeated freezing and thawing.
• Localization
  Cytoplasmic
• Properties
  If you buy Antibodies supplied by NJS poly they should be stored frozen at - 24°C for long term storage and for short term at + 5°C.
• French translation
  anticorps

• Gene target
  STMN1   Stathmin  
• Gene symbol
  STMN1
• Short name
  Anti-STMN1 / Stathmin 1
• Technique
  Antibody, antibodies against human proteins, antibodies for
• Isotype
  Rabbit IgG
• Alternative name
  Antibodies to STMN1 / Stathmin 1
• Alternative technique
  antibodies

Gene info

• Identity
  HGNC:6510
• Gene
  STMN1
• Long gene name
  stathmin 1
• Synonyms gene
  • LAP18
  • C1orf215
• Synonyms gene name
  • chromosome 1 open reading frame 215
  • stathmin 1/oncoprotein 18
• Synonyms
  • SMN
  • OP18
  • PR22
  • PP19
  • PP17
  • Lag
  • FLJ32206
• Synonyms name
  • oncoprotein 18
• GenBank acession
  • J04991
• Locus
  1p36.11
• Discovery year
  1990-12-17
• Entrez gene record
  3925
• Pubmed identfication
  • 2917975
• RefSeq identity
  • NM_005563
• Classification
  • Stathmins
  • MicroRNA protein coding host genes
• VEGA ID
  OTTHUMG00000007389

MeSH Data

• Name
  Blotting, Western
• Concept
  Scope note: Identification of proteins or peptides that have been electrophoretically separated by blot transferring from the electrophoresis gel to strips of nitrocellulose paper, followed by labeling with antibody probes.
• Tree numbers
  • E05.196.401.143
  • E05.301.300.096
  • E05.478.566.320.200
  • E05.601.262
  • E05.601.470.320.200
• Qualifiers
  ethics, trends, veterinary, history, classification, economics, instrumentation, methods, standards, statistics & numerical data

Similar products