gentaur logogentaur logo
x

RelB Antibody

  • Catalog number
    R32178
  • Product name
    RelB Antibody
  • Size
    0.1mg
  • Price
    Ask For Price
  • Contact us
    RelB Antibody
  • Short name
    Anti-RelB
  • Category
    Antibody
  • Concentration
    0.5mg/ml if reconstituted with 0.2ml sterile DI water
  • Form
    Antigen affinity purified
  • Conjugation
    Unconjugated
  • Clone
    Polyclonal antibody
  • Recognised antigen
    RelB
  • Host animal
    Rabbit (Oryctolagus cuniculus)
  • Clonality
    Polyclonal (rabbit origin)
  • Isotype
    Rabbit IgG
  • Species reactivity
    Human (Homo sapiens) ; Due to limited knowledge and inability to test the antibody against all known species, we cannot guarantee that no other cross reactivity can occur.
  • Tested applications
    WB
  • Recommended dilutions
    Western blot: 0.1-0.5ug/ml
  • Notes
    Optimal dilution of the Rel-B antibody should be determined by the researcher.
  • Intented use
    This Rel-B antibodyis to be used only for research purposes and not for diagnostics..
  • Uniprot
    Q01201
  • Purity
    Antigen affinity
  • Description
    RELB (v-rel reticuloendotheliosis viral oncogene homolog B) is also known as IREL. The International Radiation Hybrid Mapping Consortium assigned the RELB gene to chromosome 19. By RT-PCR and immunocytochemical analyses, Clark et al. (1999) showed that RELB expression correlated with dendritic cell activation. NF-kappa-B-inducing kinase is required for osteoclastogenesis in response to pathologic stimuli. Vaira et al. (2008) found that overexpression of Relb, but not Rela, rescued differentiation of mouse Nik -/- osteoclast precursors, indicating that blockade of the alternative NF-kappa-B pathway, rather than the classical NF-kappa-B pathway, is responsible for the osteoclastogenic defect in the absence of Nik. Using Relb -/- mice, they showed that Relb itself was required for Rankl-induced osteoclastogenesis in vitro and for TNF-induced bone resorption in vivo. Both Relb -/- and Nik -/- mice were resistant to tumor-mediated osteolysis. Vaira et al. (2008) concluded that the alternative NF-kappa-B pathway, via RELB, plays an essential and unique role in RANKL signaling toward osteoclast development.
  • Immunogen
    Amino acids RHSFNNLGIQCVRKKEIEAAIERKIQLGIDPYNA of human RELB were used as the immunogen for the Rel-B antibody.
  • Storage
    After reconstitution, the Rel-B antibody may be kept for up to one month refrigerated at +4 degrees C.For long-term, aliquot and store at -20 deg. Celcius or lower. Cycles of freezing and thawing can denaturate the peptide chains of the antibodies and reduce their sensitivity and/or change their affinity. Prepare aliqotes in such a manner so that freeze-thaw cycles are minimized. Avoid repeated freezing and thawing.
  • Alternative to gene target
    • [ "v-rel reticuloendotheliosis viral oncogene homolog B", "I-REL and IREL and REL-B", "RELB and IDBG-57021 and ENSG00000104856 and 5971", "protein binding", "nuclei", "Relb and IDBG-151419 and ENSMUSG00000002983 and 19698", "RELB and IDBG-639330 and ENSBTAG00000038428 and 522670" ]
  • Gene target
    RelB
    • Gene info
  • Gene symbol
    RELB
  • isotype filter
    • Rabbit IgG
  • technique filter
    • Antibody
  • Technique
    Antibody, antibodies against human proteins, antibodies for
  • Alternative technique
    antibodies