gentaur logogentaur logo
x

Cofilin 2 Antibody / CFL2

  • Catalog number
    R32400
  • Product name
    Cofilin 2 Antibody / CFL2
  • Size
    0.1mg
  • Short name
    Anti-Cofilin 2 / CFL2
  • Category
    Antibody
  • Concentration
    0.5mg/ml if reconstituted with 0.2ml sterile DI water
  • Form
    Antigen affinity purified
  • Conjugation
    Unconjugated
  • Clone
    Polyclonal antibody
  • Recognised antigen
    Cofilin 2 / CFL2
  • Host animal
    Rabbit (Oryctolagus cuniculus)
  • Clonality
    Polyclonal (rabbit origin)
  • Isotype
    Rabbit IgG
  • Species reactivity
    Human (Homo sapiens), Mouse (Mus musculus), Rat ; Due to limited knowledge and inability to test the antibody against all known species, we cannot guarantee that no other cross reactivity can occur.
  • Tested applications
    WB, IHC-P
  • Recommended dilutions
    Western blot: 0.1-0.5ug/ml,IHC (FFPE): 0.5-1ug/ml
  • Notes
    Optimal dilution of the Cofilin 2 antibody should be determined by the researcher.
  • Intented use
    This Cofilin 2 antibodyis to be used only for research purposes and not for diagnostics..
  • Uniprot
    Q9Y281
  • Purity
    Antigen affinity
  • Description
    Cofilin 2 (muscle), also known as CFL2, is a protein which in humans is encoded by the CFL2 gene. It is mapped to 14q12. This gene encodes an intracellular protein that is involved in the regulation of actin-filament dynamics. And this protein is a major component of intranuclear and cytoplasmic actin rods. It can bind G- and F-actin in a 1:1 ratio of cofilin to actin, and it reversibly controls actin polymerization and depolymerization in a pH-dependent manner. Mutations in this gene cause nemaline myopathy type 7, a form of congenital myopathy. Alternative splicing results in multiple transcript variants.
  • Immunogen
    Amino acids KDAIKKKFTGIKHEWQVNGLDDIKDRSTLGEKL were used as the immunogen for the Cofilin 2 antibody.
  • Storage
    After reconstitution, the Cofilin 2 antibody may be kept for up to one month refrigerated at +4 degrees C.For long-term, aliquot and store at -20 deg. Celcius or lower. Cycles of freezing and thawing can denaturate the peptide chains of the antibodies and reduce their sensitivity and/or change their affinity. Prepare aliqotes in such a manner so that freeze-thaw cycles are minimized. Avoid repeated freezing and thawing.
  • Localization
    Cytoplasmic
  • Gene target
    Cofilin 2 / CFL2
    • Gene info
    Locus Specific Databases:Leiden Muscular Dystrophy pagesLRG_213
  • Gene symbol
    CFL2
  • isotype filter
    • Rabbit IgG
  • technique filter
    • Antibody
  • Technique
    Antibody, antibodies against human proteins, antibodies for
  • Alternative technique
    antibodies