- Catalog number70R-1587
- Product nameRabbit Semenogelin I antibody
- Size100 ug
- PriceAsk For Price
- ApplicationsWB, IHC
- Product TypePrimary Antibodies
- Product SubtypePurified Polyclonal Antibodies
- Research AreaDifferentiation & Development
- ImmunogenSemenogelin I antibody was raised using the N terminal of SEMG1 corresponding to a region with amino acids QKGKQQTESKGSFSIQYTYHVDANDHDQSRKSQQYDLNALHKTTKSQRHL
- HostRabbit, Rabbits
- SpecificitySemenogelin I antibody was raised against the N terminal of SEMG1
- Cross ReactivityHuman
- IsotypeNA
- CloneNA
- Concentration1 mg/ml
- Form BufferLyophilized powder. Add 100ul distilled water for a 1mg/ml concentration of SEMG1 antibody in PBS
- StorageStore at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.
- Shipping InfoBlue Ice
- Gene targetSemenogelin I
- Identity:HGNC:10742
- Gene:SEMG1
- Long gene name:semenogelin 1
- Synonyms gene name:semenogelin I
- Synonyms:CT103
- Discovery year:1991-09-13
- Entrez gene record:6406
- Pubmed identification:2912989, 15563730
- RefSeq identity:NM_003007
- VEGA ID:OTTHUMG00000032565
- Gene symbolSEMG1
- isotype filter
- NA
- Short nameRabbit Semenogelin I antibody
- technique filter
- Antibody
- Rabbit
- TechniqueAntibody, Rabbit, antibodies against human proteins, antibodies for
- Alternative techniqueantibodies, rabbit-anti