gentaur logogentaur logo
x

Nitric Oxide Synthase Detection Kit – NO

  • Catalog number
    70R-1937
  • Product name
    RORA antibody
  • Size
    50 µg
  • Price
    Ask For Price
  • Contact us
    RORA antibody
  • Category
    Primary Antibody
  • Antibody Subtype
    Polyclonal Antibodies, Purified
  • Area of research
    Cancer
  • Type of Immunogen
    RORA antibodies were raised using the N terminal of RORA corresponding to a region with amino acids ARKSEPPAPVRRQSYSSTSRGISVTKKTHTSQIEIIPCKICGDKSSGIHY
  • Raised in
    Rabbit
  • Specificity
    RORA antibody was raised against the N terminal of RORA
  • Cross Reactivity
    Human,Mouse,Rat
  • Method of Purification
    Affinity purified
  • Concentration
    1 mg/ml
  • Form Buffer
    Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of RORA antibody in PBS
  • Storage
    Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.
  • Shipping conditions
    Blue Ice
  • Tested for
    WB
  • Usage Recommendations
    WB: 1 ug/ml
  • Assay Information
    RORA Blocking Peptide, catalog no. 33R-1478, is also available for use as a blocking control in assays to test for specificity of this RORA antibody
  • Additional Information
    This is a rabbit polyclonal antibody against RORA, which has been validated by Western Blot. We usually provide antibodies covering each member of a whole protein family of your interest. We also use our best efforts to provide you antibodies recognize various epitopes of a target protein. For availability of antibody needed for your experiment, please inquire at [email protected]
  • URL
    URL
  • More info
    More_info
  • Alternative to gene target
    • [ "RAR-related orphan receptor A", "NR1F1 and ROR1 and ROR2 and ROR3 and RZR-ALPHA and RZRA", "RORA and IDBG-14920 and ENSG00000069667 and 6095", "direct ligand regulated sequence-specific DNA binding transcription factor activity", "nuclei", "Rora and IDBG-181478 and ENSMUSG00000032238 and 19883", "RORA and IDBG-646570 and ENSBTAG00000015904 and 535597,790889" ]
  • Gene target
    RORA
    • Gene info
    Gene info
    Gene info
  • Gene symbol
    RORA-AS1, RORA-AS2, RORA
  • Short name
    RORA antibody
  • technique filter
    • Antibody
  • Technique
    Antibody, antibodies against human proteins, antibodies for
  • Alternative technique
    antibodies