gentaur logogentaur logo
x

Ubiquitin D antibody

  • Catalog number
    70R-5744
  • Product name
    Ubiquitin D antibody
  • Size
    50 µg
  • Category
    Primary Antibody
  • Antibody Subtype
    Polyclonal Antibodies, Purified
  • Area of research
    Protein Modification & Stress Response
  • Type of Immunogen
    Ubiquitin D antibodies were raised using the N terminal of UBD corresponding to a region with amino acids RSKTKVPVQDQVLLLGSKILKPRRSLSSYGIDKEKTIHLTLKVVKPSDEE
  • Raised in
    Rabbit
  • Specificity
    Ubiquitin D antibody was raised against the N terminal of UBD
  • Cross Reactivity
    Human
  • Method of Purification
    Affinity purified
  • Concentration
    1 mg/ml
  • Form Buffer
    Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of UBD antibody in PBS
  • Storage
    Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.
  • Shipping conditions
    Blue Ice
  • Tested for
    WB
  • Usage Recommendations
    WB: 1 ug/ml
  • Assay Information
    Ubiquitin D Blocking Peptide, catalog no. 33R-8192, is also available for use as a blocking control in assays to test for specificity of this Ubiquitin D antibody
  • Additional Information
    This is a rabbit polyclonal antibody against UBD, which has been validated by Western Blot. We usually provide antibodies covering each member of a whole protein family of your interest. We also use our best efforts to provide you antibodies recognize various epitopes of a target protein. For availability of antibody needed for your experiment, please inquire at [email protected]
  • URL
    URL
  • More info
    More_info
  • Gene target
    Ubiquitin D
    • Gene info
    Gene info
    Gene info
  • Gene symbol
    UBD, UBDP1, UBE2DNL
  • Short name
    Ubiquitin D antibody
  • technique filter
    • Antibody
  • Technique
    Antibody, antibodies against human proteins, antibodies for
  • Alternative technique
    antibodies