- Catalog number70R-4344
- Product nameTPRKB antibody
- Size50 µg
- PriceAsk For Price
- CategoryPrimary Antibody
- Antibody SubtypePolyclonal Antibodies, Purified
- Area of researchMiscellaneous
- Type of ImmunogenTPRKB antibodies were raised using the middle region of TPRKB corresponding to a region with amino acids EGTIDGSLINPTVIVDPFQILVAANKAVHLYKLGKMKTRTLSTEIIFNLS
- Raised inRabbit
- SpecificityTPRKB antibody was raised against the middle region of TPRKB
- Cross ReactivityHuman, Mouse, Rat
- Method of PurificationAffinity purified
- Concentration1 mg/ml
- Form BufferLyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of TPRKB antibody in PBS
- StorageStore at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.
- Shipping conditionsBlue Ice
- Tested forWB
- Usage RecommendationsWB: 1 ug/ml
- Assay InformationTPRKB Blocking Peptide, catalog no. 33R-2447, is also available for use as a blocking control in assays to test for specificity of this TPRKB antibody
- Additional InformationThis is a rabbit polyclonal antibody against TPRKB, which has been validated by Western Blot. We usually provide antibodies covering each member of a whole protein family of your interest. We also use our best efforts to provide you antibodies recognize various epitopes of a target protein. For availability of antibody needed for your experiment, please inquire at [email protected]
- URL
- More info
- Gene targetTPRKB
- Identity:HGNC:24259
- Gene:TPRKB
- Long gene name:TP53RK binding protein
- Synonyms:CGI-121CGI121
- Discovery year:2006-02-02
- Entrez gene record:51002
- Pubmed identification:10810093, 12659830
- RefSeq identity:NM_016058
- Classification:KEOPS complex
- VEGA ID:OTTHUMG00000129815
- Identity:HGNC:16197
- Gene:TP53RK
- Long gene name:TP53 regulating kinase
- Synonyms gene name:chromosome 20 open reading frame 64
- Synonyms:dJ101A2.2prpkNori-2pBUD32TPRKB
- Discovery year:2001-07-17
- Entrez gene record:112858
- Pubmed identification:11546806, 12914926
- RefSeq identity:NM_033550
- Classification:KEOPS complex
- VEGA ID:OTTHUMG00000085887
- Gene symbolTPRKB, TP53RK
- Short nameTPRKB antibody
- technique filter
- Antibody
- TechniqueAntibody, antibodies against human proteins, antibodies for
- Alternative techniqueantibodies