gentaur logogentaur logo
x

STK38 antibody

  • Catalog number
    70R-5769
  • Product name
    STK38 antibody
  • Size
    50 µg
  • Price
    Ask For Price
  • Contact us
    STK38 antibody
  • Category
    Primary Antibody
  • Antibody Subtype
    Polyclonal Antibodies, Purified
  • Area of research
    Signal Transduction
  • Type of Immunogen
    STK38 antibodies were raised using the C terminal of STK38 corresponding to a region with amino acids IGAPGVEEIKSNSFFEGVDWEHIRERPAAISIEIKSIDDTSNFDEFPESD
  • Raised in
    Rabbit
  • Specificity
    STK38 antibody was raised against the C terminal of STK38
  • Cross Reactivity
    Human,Mouse,Rat
  • Method of Purification
    Affinity purified
  • Concentration
    1 mg/ml
  • Form Buffer
    Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of STK38 antibody in PBS
  • Storage
    Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.
  • Shipping conditions
    Blue Ice
  • Tested for
    WB
  • Usage Recommendations
    WB: 1 ug/ml
  • Assay Information
    STK38 Blocking Peptide, catalog no. 33R-3966, is also available for use as a blocking control in assays to test for specificity of this STK38 antibody
  • Additional Information
    This is a rabbit polyclonal antibody against STK38, which has been validated by Western Blot. We usually provide antibodies covering each member of a whole protein family of your interest. We also use our best efforts to provide you antibodies recognize various epitopes of a target protein. For availability of antibody needed for your experiment, please inquire at [email protected]
  • URL
    URL
  • More info
    More_info
  • Alternative to gene target
    • [ "serine/threonine kinase 38", "NDR and NDR1", "STK38 and IDBG-84955 and ENSG00000112079 and 11329", "transferase activity", "nuclei", "Stk38 and IDBG-159635 and ENSMUSG00000024006 and 106504", "STK38 and IDBG-630139 and ENSBTAG00000011126 and 533677" ]
  • Gene target
    STK38
    • Gene info
  • Gene symbol
    STK38
  • Short name
    STK38 antibody
  • technique filter
    • Antibody
  • Technique
    Antibody, antibodies against human proteins, antibodies for
  • Alternative technique
    antibodies