- Catalog number70R-2278
- Product nameSPNS2 antibody
- Size50 µg
- PriceAsk For Price
- CategoryPrimary Antibody
- Antibody SubtypePolyclonal Antibodies, Purified
- Area of researchCell Biology
- Type of ImmunogenSPNS2 antibodies were raised using a synthetic peptide corresponding to a region with amino acids PPGTPGTPGCAATAKGPGAQQPKPASLGRGRGAAAAILSLGNVLNYLDRY
- Raised inRabbit
- Cross ReactivityHuman
- Method of PurificationAffinity purified
- Concentration1 mg/ml
- Form BufferLyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of SPNS2 antibody in PBS
- StorageStore at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.
- Shipping conditionsBlue Ice
- Tested forWB
- Usage RecommendationsWB: 1 ug/ml
- Assay InformationSPNS2 Blocking Peptide, catalog no. 33R-7255, is also available for use as a blocking control in assays to test for specificity of this SPNS2 antibody
- Additional InformationThis is a rabbit polyclonal antibody against SPNS2, which has been validated by Western Blot. We usually provide antibodies covering each member of a whole protein family of your interest. We also use our best efforts to provide you antibodies recognize various epitopes of a target protein. For availability of antibody needed for your experiment, please inquire at [email protected]
- URL
- More info
- Gene targetSPNS2
- Identity:HGNC:26992
- Gene:SPNS2
- Long gene name:sphingolipid transporter 2
- Synonyms gene name:spinster homolog 2 (Drosophila)
- Synonyms:SLC63A2
- Discovery year:2007-04-12
- Entrez gene record:124976
- Pubmed identification:12815463, 26324848
- Classification:Solute carriers
- VEGA ID:OTTHUMG00000177739
- Identity:HGNC:55787
- Gene:SPNS2-AS1
- Long gene name:SPNS2 antisense RNA 1
- Discovery year:2021-07-28
- Entrez gene record:107985053
- Classification:Antisense RNAs
- Gene symbolSPNS2, SPNS2-AS1
- Short nameSPNS2 antibody
- technique filter
- Antibody
- TechniqueAntibody, antibodies against human proteins, antibodies for
- Alternative techniqueantibodies