gentaur logogentaur logo
x

RSU1 antibody

  • Catalog number
    70R-1142
  • Product name
    RSU1 antibody
  • Size
    100 µg
  • Price
    Ask For Price
  • Contact us
    RSU1 antibody
  • Category
    Primary Antibody
  • Antibody Subtype
    Polyclonal Antibodies, Purified
  • Area of research
    Proteases, Inhibitors, & Enzymes
  • Type of Immunogen
    RSU1 antibodies were raised using the C terminal of RSU1 corresponding to a region with amino acids PIADQFQLGVSHVFEYIRSETYKYLYGRHMQANPEPPKKNNDKSKKISRK
  • Raised in
    Rabbit
  • Specificity
    RSU1 antibody was raised against the C terminal of RSU1
  • Cross Reactivity
    Human, Mouse, Rat
  • Method of Purification
    Total IgG Protein A purified
  • Concentration
    1 mg/ml
  • Form Buffer
    Lyophilized powder. Add 100ul distilled water for a 1mg/ml concentration of RSU1 antibody in PBS
  • Storage
    Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.
  • Shipping conditions
    Blue Ice
  • Tested for
    WB; IHC
  • Usage Recommendations
    WB: 1.25 ug/ml; IHC: 4-8 ug/ml
  • Assay Information
    RSU1 Blocking Peptide, catalog no. 33R-7149, is also available for use as a blocking control in assays to test for specificity of this RSU1 antibody
  • Additional Information
    This is a rabbit polyclonal antibody against RSU1. It was validated on Western Blot and immunohistochemistry. We usually provide antibodies covering each member of a whole protein family of your interest. We also use our best efforts to provide you antibodies recognize various epitopes of a target protein. For availability of antibody needed for your experiment, please inquire at [email protected]
  • URL
    URL
  • More info
    More_info
  • Gene target
    RSU1
    • Gene info
  • Gene symbol
    RSU1
  • Short name
    RSU1 antibody
  • technique filter
    • Antibody
  • Technique
    Antibody, antibodies against human proteins, antibodies for
  • Alternative technique
    antibodies