- Catalog number70R-1618
- Product nameRRM1 antibody
- Size100 µg
- PriceAsk For Price
- CategoryPrimary Antibody
- Antibody SubtypePolyclonal Antibodies, Purified
- Area of researchCancer
- Type of ImmunogenRRM1 antibodies were raised using the N terminal of RRM1 corresponding to a region with amino acids ATGSYIAGTNGNSNGLVPMLRVYNNTARYVDQGGNKRPGAFAIYLEPWHL
- Raised inRabbit
- SpecificityRRM1 antibody was raised against the N terminal of RRM1
- Cross ReactivityHuman,Mouse,Rat,Dog,C.elegans,ZebraFish
- Method of PurificationTotal IgG Protein A purified
- Concentration1 mg/ml
- Form BufferLyophilized powder. Add 100ul distilled water for a 1mg/ml concentration of RRM1 antibody in PBS
- StorageStore at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.
- Shipping conditionsBlue Ice
- Tested forWB
- Usage RecommendationsWB: 1.25 ug/ml
- Assay InformationRRM1 Blocking Peptide, catalog no. 33R-1558, is also available for use as a blocking control in assays to test for specificity of this RRM1 antibody
- Additional InformationThis is a rabbit polyclonal antibody against RRM1, which has been validated by Western Blot. We usually provide antibodies covering each member of a whole protein family of your interest. We also use our best efforts to provide you antibodies recognize various epitopes of a target protein. For availability of antibody needed for your experiment, please inquire at [email protected]
- URL
- More info
- Gene targetRRM1
- Identity:HGNC:10451
- Gene:RRM1
- Long gene name:ribonucleotide reductase catalytic subunit M1
- Synonyms gene name:ribonucleotide reductase M1 polypeptide
- Discovery year:1986-01-01
- Entrez gene record:6240
- Pubmed identification:7557993
- RefSeq identity:NM_001033
- VEGA ID:OTTHUMG00000133361
- Identity:HGNC:40512
- Gene:RRM1-AS1
- Long gene name:RRM1 antisense RNA 1
- Synonyms gene name:RRM1 antisense RNA 1 (non-protein coding)
- Discovery year:2011-11-18
- Classification:Antisense RNAs
- VEGA ID:OTTHUMG00000165304
- Gene symbolRRM1, RRM1-AS1
- Short nameRRM1 antibody
- technique filter
- Antibody
- TechniqueAntibody, antibodies against human proteins, antibodies for
- Alternative techniqueantibodies
Gene info
Locus Specific Databases:LRG_324