Rabbit TNFSF18 antibody
-
Catalog number70R-6010
-
PricePlease ask
-
Size50 ug
-
-
ApplicationsWB
-
Product TypePrimary Antibodies
-
Product SubtypePurified Polyclonal Antibodies
-
Research AreaCell Cycle & Cell Death
-
ImmunogenTNFSF18 antibody was raised using a synthetic peptide corresponding to a region with amino acids KLEILQNGLYLIYGQVAPNANYNDVAPFEVRLYKNKDMIQTLTNKSKIQN
-
SpecificityNA
-
Cross ReactivityHuman
-
CloneNA
-
Concentration1 mg/ml
-
Form BufferLyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of TNFSF18 antibody in PBS
-
StorageStore at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.
-
Shipping InfoBlue Ice
-
PropertiesIf you buy Antibodies supplied by fitzgerald they should be stored frozen at - 24°C for long term storage and for short term at + 5°C.
-
AboutRabbits are used for polyclonal antibody production by fitzgerald. Rabbit antibodies are very stable and can be stored for several days at room temperature. fitzgerald adds sodium azide and glycerol to enhance the stability of the rabbit polyclonal antibodies. Anti-human, anti mouse antibodies to highly immunogenic selected peptide sequences are" monoclonal like" since the epitope to which they are directed is less than 35 amino acids long.
-
Latin nameOryctolagus cuniculus
-
French translationanticorps
-
Gene target
-
Gene symbolTNFSF18
-
Short nameRabbit TNFSF18 antibody
-
TechniqueAntibody, Rabbit, antibodies against human proteins, antibodies for
-
HostRabbit, Rabbits
-
IsotypeNA
-
Alternative nameRabbit polyclonal TNFSF18 antibody
-
Alternative techniqueantibodies, rabbit-anti
-
Alternative to gene targettumor necrosis factor (ligand) superfamily, member 18, AITRL and GITRL and hGITRL and TL6, TNFSF18 and IDBG-104861 and ENSG00000120337 and 8995, tumor necrosis factor receptor superfamily binding, Extracellular, Tnfsf18 and IDBG-201543 and ENSMUSG00000066755 and 240873, LOC768081 and IDBG-632315 and ENSBTAG00000047412 and 768081
-
Gene info
-
Identity
-
Gene
-
Long gene nameTNF superfamily member 18
-
Synonyms gene name
- tumor necrosis factor (ligand) superfamily, member 18
-
Synonyms
-
GenBank acession
-
Locus
-
Discovery year1999-01-15
-
Entrez gene record
-
Pubmed identfication
-
RefSeq identity
-
Classification
- Tumor necrosis factor superfamily
-
VEGA ID
MeSH Data
-
Name
-
ConceptScope note: Identification of proteins or peptides that have been electrophoretically separated by blot transferring from the electrophoresis gel to strips of nitrocellulose paper, followed by labeling with antibody probes.
-
Tree numbers
- E05.196.401.143
- E05.301.300.096
- E05.478.566.320.200
- E05.601.262
- E05.601.470.320.200
-
Qualifiersethics, trends, veterinary, history, classification, economics, instrumentation, methods, standards, statistics & numerical data