- Catalog number70R-4605
- Product nameRabbit TMPRSS6 antibody
- Size50 ug
- PriceAsk For Price
- ApplicationsWB
- Product TypePrimary Antibodies
- Product SubtypePurified Polyclonal Antibodies
- Research AreaProteases, Inhibitors, & Enzymes
- ImmunogenTMPRSS6 antibody was raised using the N terminal of TMPRSS6 corresponding to a region with amino acids LLWYFLGYKAEVMVSQVYSGSLRVLNRHFSQDLTRRESSAFRSETAKAQK
- HostRabbit, Rabbits
- SpecificityTMPRSS6 antibody was raised against the N terminal of TMPRSS6
- Cross ReactivityHuman,Mouse,Rat
- IsotypeNA
- CloneNA
- Concentration1 mg/ml
- Form BufferLyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of TMPRSS6 antibody in PBS
- StorageStore at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.
- Shipping InfoBlue Ice
- Gene targetTMPRSS6
- Identity:HGNC:16517
- Gene:TMPRSS6
- Long gene name:transmembrane serine protease 6
- Synonyms gene name:transmembrane protease, serine 6
- Synonyms:FLJ30744MT2
- Discovery year:2003-12-17
- Entrez gene record:164656
- RefSeq identity:NM_153609
- Classification:Type II transmembrane serine proteases
- VEGA ID:OTTHUMG00000150541
- Gene symbolTMPRSS6
- isotype filter
- NA
- Short nameRabbit TMPRSS6 antibody
- technique filter
- Antibody
- Rabbit
- TechniqueAntibody, Rabbit, antibodies against human proteins, antibodies for
- Alternative techniqueantibodies, rabbit-anti
Gene info
Locus Specific Databases:LRG_1128