- Catalog number70R-3180
- Product nameRabbit TIPARP antibody
- Size50 ug
- PriceAsk For Price
- ApplicationsWB
- Product TypePrimary Antibodies
- Product SubtypePurified Polyclonal Antibodies
- Research AreaDNA & RNA
- ImmunogenTIPARP antibody was raised using a synthetic peptide corresponding to a region with amino acids LKTCFKKKDQKRLGTGTLRSLRPILNTLLESGSLDGVFRSRNQSTDENSL
- HostRabbit, Rabbits
- SpecificityNA
- Cross ReactivityHuman
- IsotypeNA
- CloneNA
- Concentration1 mg/ml
- Form BufferLyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of TIPARP antibody in PBS
- StorageStore at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.
- Shipping InfoBlue Ice
- Alternative to gene target
- [ "TCDD-inducible poly(ADP-ribose) polymerase", "ARTD14 and PARP7 and pART14", "TIPARP and IDBG-62730 and ENSG00000163659 and 25976", "metal ion binding", "nuclei", "Tiparp and IDBG-149381 and ENSMUSG00000034640 and 99929", "TIPARP and IDBG-637301 and ENSBTAG00000012120 and 540975" ]
- Gene targetTIPARP
- Identity:HGNC:41028
- Gene:TIPARP-AS1
- Long gene name:TIPARP antisense RNA 1
- Synonyms gene name:TIPARP antisense RNA 1 (non-protein coding)
- Discovery year:2011-07-25
- Entrez gene record:100287227
- RefSeq identity:NR_027954
- Classification:Antisense RNAs
- VEGA ID:OTTHUMG00000158643
- Identity:HGNC:23696
- Gene:TIPARP
- Long gene name:TCDD inducible poly(ADP-ribose) polymerase
- Synonyms gene name:TCDD-inducible poly(ADP-ribose) polymerase
- Synonyms:DKFZP434J214DKFZp686N0351DDF1PARP7PARP-7PARP-1pART14RM1ARTD14
- Discovery year:2003-12-02
- Entrez gene record:25976
- Pubmed identification:12851707
- RefSeq identity:NM_015508
- Classification:Poly(ADP-ribose) polymerases
- VEGA ID:OTTHUMG00000158646
- Gene symbolTIPARP-AS1, TIPARP
- isotype filter
- NA
- Short nameRabbit TIPARP antibody
- technique filter
- Antibody
- Rabbit
- TechniqueAntibody, Rabbit, antibodies against human proteins, antibodies for
- Alternative techniqueantibodies, rabbit-anti