- Catalog number70R-1009
- Product nameRabbit SIRT5 antibody
- Size100 ug
- PriceAsk For Price
- ApplicationsWB
- Product TypePrimary Antibodies
- Product SubtypePurified Polyclonal Antibodies
- Research AreaCell Biology
- ImmunogenSIRT5 antibody was raised using the C terminal of SIRT5 corresponding to a region with amino acids HCDLCLVVGTSSVVYPAAMFAPQVAARGVPVAEFNTETTPATNRFSHLIS
- HostRabbit, Rabbits
- SpecificitySIRT5 antibody was raised against the C terminal of SIRT5
- Cross ReactivityHuman
- IsotypeNA
- CloneNA
- Concentration1 mg/ml
- Form BufferLyophilized powder. Add 100ul distilled water for a 1mg/ml concentration of SIRT5 antibody in PBS
- StorageStore at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.
- Shipping InfoBlue Ice
- Gene targetSIRT5
- Identity:HGNC:14933
- Gene:SIRT5
- Long gene name:sirtuin 5
- Synonyms gene name:sirtuin (silent mating type information regulation 2, S.cerevisiae, homolog) 5, sirtuin (silent mating type information regulation 2 homolog) 5 (S. cerevisiae)
- Discovery year:2001-03-20
- Entrez gene record:23408
- Pubmed identification:10381378
- Classification:Sirtuins
- VEGA ID:OTTHUMG00000014278
- Gene symbolSIRT5
- isotype filter
- NA
- Short nameRabbit SIRT5 antibody
- technique filter
- Antibody
- Rabbit
- TechniqueAntibody, Rabbit, antibodies against human proteins, antibodies for
- Alternative techniqueantibodies, rabbit-anti