- Catalog number70R-5915
- Product nameRabbit SERPINA3 antibody
- Size50 ug
- PriceAsk For Price
- ApplicationsWB
- Product TypePrimary Antibodies
- Product SubtypePurified Polyclonal Antibodies
- Research AreaProteases, Inhibitors, & Enzymes
- ImmunogenSERPINA3 antibody was raised using the middle region of SERPINA3 corresponding to a region with amino acids FRDEELSCTVVELKYTGNASALFILPDQDKMEEVEAMLLPETLKRWRDSL
- HostRabbit, Rabbits
- SpecificitySERPINA3 antibody was raised against the middle region of SERPINA3
- Cross ReactivityHuman,Mouse,Rat
- IsotypeNA
- CloneNA
- Concentration1 mg/ml
- Form BufferLyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of SERPINA3 antibody in PBS
- StorageStore at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.
- Shipping InfoBlue Ice
- Alternative to gene target
- [ "serpin peptidase inhibitor, clade A (alpha-1 antiproteinase, antitrypsin), member 3", "SERPINA3 and IDBG-18406 and ENSG00000196136 and 12", "protein binding", "nuclei" ]
- Gene targetSERPINA3
- Identity:HGNC:16
- Gene:SERPINA3
- Long gene name:serpin family A member 3
- Synonyms gene name:alpha-1-antichymotrypsin, serine (or cysteine) proteinase inhibitor, clade A (alpha-1 antiproteinase, antitrypsin), member 3, serpin peptidase inhibitor, clade A (alpha-1 antiproteinase, antitrypsin), member 3
- Synonyms:ACT,
- Discovery year:2001-06-22
- Entrez gene record:12
- Pubmed identification:3260956, 24172014
- RefSeq identity:NM_001085
- Classification:Serpin peptidase inhibitors
- VEGA ID:OTTHUMG00000029851
- Gene symbolSERPINA3
- isotype filter
- NA
- Short nameRabbit SERPINA3 antibody
- technique filter
- Antibody
- Rabbit
- TechniqueAntibody, Rabbit, antibodies against human proteins, antibodies for
- Alternative techniqueantibodies, rabbit-anti