- Catalog number70R-6632
- Product nameRabbit RHBDF1 antibody
- Size50 ug
- PriceAsk For Price
- ApplicationsWB
- Product TypePrimary Antibodies
- Product SubtypePurified Polyclonal Antibodies
- Research AreaCell Biology
- ImmunogenRHBDF1 antibody was raised using a synthetic peptide corresponding to a region with amino acids KDWEKAPEQADLTGGALDRSELERSHLMLPLERGWRKQKEGAAAPQPKVR
- HostRabbit, Rabbits
- SpecificityNA
- Cross ReactivityHuman,Mouse,Rat
- IsotypeNA
- CloneNA
- Concentration1 mg/ml
- Form BufferLyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of RHBDF1 antibody in PBS
- StorageStore at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.
- Shipping InfoBlue Ice
- Gene targetRHBDF1
- Identity:HGNC:20561
- Gene:RHBDF1
- Long gene name:rhomboid 5 homolog 1
- Synonyms gene name:chromosome 16 open reading frame 8, rhomboid family 1 (Drosophila), rhomboid 5 homolog 1 (Drosophila)
- Synonyms:EGFR-RS, FLJ2235, Dist1iRhom1
- Discovery year:2003-04-07
- Entrez gene record:64285
- Pubmed identification:8318735, 15965977
- RefSeq identity:NM_022450
- Classification:Rhomboid family
- VEGA ID:OTTHUMG00000060719
- Gene symbolRHBDF1
- isotype filter
- NA
- Short nameRabbit RHBDF1 antibody
- technique filter
- Antibody
- Rabbit
- TechniqueAntibody, Rabbit, antibodies against human proteins, antibodies for
- Alternative techniqueantibodies, rabbit-anti