- Catalog number70R-2775
- Product nameRabbit RFPL4B antibody
- Size50 ug
- PriceAsk For Price
- ApplicationsWB
- Product TypePrimary Antibodies
- Product SubtypePurified Polyclonal Antibodies
- Research AreaProtein Modification & Stress Response
- ImmunogenRFPL4B antibody was raised using the middle region of RFPL4B corresponding to a region with amino acids MTKQHNSRLEQSLHVREELRHFREDVTLDAATASSLLVFSNDLRSAQCKK
- HostRabbit, Rabbits
- SpecificityRFPL4B antibody was raised against the middle region of RFPL4B
- Cross ReactivityHuman
- IsotypeNA
- CloneNA
- Concentration1 mg/ml
- Form BufferLyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of RFPL4B antibody in PBS
- StorageStore at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.
- Shipping InfoBlue Ice
- Gene targetRFPL4B
- Identity:HGNC:33264
- Gene:RFPL4B
- Long gene name:ret finger protein like 4B
- Synonyms:RNF211
- Discovery year:2007-01-19
- Entrez gene record:442247
- RefSeq identity:NM_001013734
- Classification:Ring finger proteins
- VEGA ID:OTTHUMG00000015390
- Gene symbolRFPL4B
- isotype filter
- NA
- Short nameRabbit RFPL4B antibody
- technique filter
- Antibody
- Rabbit
- TechniqueAntibody, Rabbit, antibodies against human proteins, antibodies for
- Alternative techniqueantibodies, rabbit-anti