- Catalog number70R-4330
- Product nameRabbit PSPH antibody
- Size50 ug
- PriceAsk For Price
- ApplicationsWB
- Product TypePrimary Antibodies
- Product SubtypePurified Polyclonal Antibodies
- Research AreaSignal Transduction
- ImmunogenPSPH antibody was raised using the middle region of PSPH corresponding to a region with amino acids IMIGDGATDMEACPPADAFIGFGGNVIRQQVKDNAKWYITDFVELLGELE
- HostRabbit, Rabbits
- SpecificityPSPH antibody was raised against the middle region of PSPH
- Cross ReactivityHuman,Mouse,Rat
- IsotypeNA
- CloneNA
- Concentration1 mg/ml
- Form BufferLyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of PSPH antibody in PBS
- StorageStore at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.
- Shipping InfoBlue Ice
- Gene targetPSPH
- Gene symbolPSPH
- isotype filter
- NA
- Short nameRabbit PSPH antibody
- technique filter
- Antibody
- Rabbit
- TechniqueAntibody, Rabbit, antibodies against human proteins, antibodies for
- Alternative techniqueantibodies, rabbit-anti