- Catalog number70R-5630
- Product nameRabbit PSMD1 antibody
- Size50 ug
- PriceAsk For Price
- ApplicationsWB
- Product TypePrimary Antibodies
- Product SubtypePurified Polyclonal Antibodies
- Research AreaProtein Modification & Stress Response
- ImmunogenPSMD1 antibody was raised using a synthetic peptide corresponding to a region with amino acids HYTKQCVENADLPEGEKKPIDQRLEGIVNKMFQRCLDDHKYKQAIGIALE
- HostRabbit, Rabbits
- SpecificityNA
- Cross ReactivityHuman,Mouse,Rat
- IsotypeNA
- CloneNA
- Concentration1 mg/ml
- Form BufferLyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of PSMD1 antibody in PBS
- StorageStore at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.
- Shipping InfoBlue Ice
- Alternative to gene target
- [ "proteasome (prosome, macropain) 26S subunit, non-ATPase, 1", "P112 and Rpn2 and S1", "PSMD1 and IDBG-83029 and ENSG00000173692 and 5707", "enzyme regulator activity", "nuclei", "PSMD1 and IDBG-644368 and ENSBTAG00000005119 and 511803" ]
- Gene targetPSMD1
- Identity:HGNC:9554
- Gene:PSMD1
- Long gene name:proteasome 26S subunit, non-ATPase 1
- Synonyms gene name:proteasome (prosome, macropain) 26S subunit, non-ATPase, 1
- Synonyms:S1P112Rpn2
- Discovery year:1995-11-28
- Entrez gene record:5707
- Pubmed identification:8816993
- Classification:Proteasome, Armadillo like helical domain containing
- VEGA ID:OTTHUMG00000133223
- Gene symbolPSMD1
- isotype filter
- NA
- Short nameRabbit PSMD1 antibody
- technique filter
- Antibody
- Rabbit
- TechniqueAntibody, Rabbit, antibodies against human proteins, antibodies for
- Alternative techniqueantibodies, rabbit-anti