- Catalog number70R-5581
- Product nameRabbit POLB antibody
- Size50 ug
- PriceAsk For Price
- ApplicationsWB
- Product TypePrimary Antibodies
- Product SubtypePurified Polyclonal Antibodies
- Research AreaDNA & RNA
- ImmunogenPOLB antibody was raised using a synthetic peptide corresponding to a region with amino acids GPSAARKFVDEGIKTLEDLRKNEDKLNHHQRIGLKYFGDFEKRIPREEML
- HostRabbit, Rabbits
- SpecificityNA
- Cross ReactivityHuman,Mouse,Rat
- IsotypeNA
- CloneNA
- Concentration1 mg/ml
- Form BufferLyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of POLB antibody in PBS
- StorageStore at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.
- Shipping InfoBlue Ice
- Alternative to gene target
- [ "polymerase (DNA directed), beta", "POLB and IDBG-20094 and ENSG00000070501 and 102723810,5423", "metal ion binding", "nuclei", "Polb and IDBG-140909 and ENSMUSG00000031536 and 18970", "POLB and IDBG-629853 and ENSBTAG00000000225 and 614688" ]
- Gene targetPOLB
- Identity:HGNC:9174
- Gene:POLB
- Long gene name:DNA polymerase beta
- Synonyms gene name:polymerase (DNA directed), beta, polymerase (DNA) beta
- Discovery year:2001-06-22
- Entrez gene record:5423
- RefSeq identity:NM_002690
- Classification:DNA polymerases
- VEGA ID:OTTHUMG00000164093
- Gene symbolPOLB
- isotype filter
- NA
- Short nameRabbit POLB antibody
- technique filter
- Antibody
- Rabbit
- TechniqueAntibody, Rabbit, antibodies against human proteins, antibodies for
- Alternative techniqueantibodies, rabbit-anti