- Catalog number70R-2454
- Product nameRabbit PDK2 antibody
- Size50 ug
- PriceAsk For Price
- ApplicationsWB
- Product TypePrimary Antibodies
- Product SubtypePurified Polyclonal Antibodies
- Research AreaProteases, Inhibitors, & Enzymes
- ImmunogenPDK2 antibody was raised using the middle region of PDK2 corresponding to a region with amino acids ELFKNAMRATVESHESSLILPPIKVMVALGEEDLSIKMSDRGGGVPLRKI
- HostRabbit, Rabbits
- SpecificityPDK2 antibody was raised against the middle region of PDK2
- Cross ReactivityHuman
- IsotypeNA
- CloneNA
- Concentration1 mg/ml
- Form BufferLyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of PDK2 antibody in PBS
- StorageStore at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.
- Shipping InfoBlue Ice
- Gene targetPDK2
- Identity:HGNC:8810
- Gene:PDK2
- Long gene name:pyruvate dehydrogenase kinase 2
- Synonyms gene name:pyruvate dehydrogenase kinase, isoenzyme 2, pyruvate dehydrogenase kinase, isozyme 2
- Synonyms:PDHK2,
- Discovery year:1996-08-14
- Entrez gene record:5164
- Pubmed identification:7499431
- RefSeq identity:NM_002611
- VEGA ID:OTTHUMG00000161948
- Gene symbolPDK2
- isotype filter
- NA
- Short nameRabbit PDK2 antibody
- technique filter
- Antibody
- Rabbit
- TechniqueAntibody, Rabbit, antibodies against human proteins, antibodies for
- Alternative techniqueantibodies, rabbit-anti