- Catalog number70R-6121
- Product nameRabbit PCDHAC2 antibody
- Size50 ug
- PriceAsk For Price
- ApplicationsWB
- Product TypePrimary Antibodies
- Product SubtypePurified Polyclonal Antibodies
- Research AreaCell Biology
- ImmunogenPCDHAC2 antibody was raised using the N terminal of PCDHAC2 corresponding to a region with amino acids SPAFDQSTYRVQLREDSPPGTLVVKLNASDPDEGSNGELRYSLSSYTSDR
- HostRabbit, Rabbits
- SpecificityPCDHAC2 antibody was raised against the N terminal of PCDHAC2
- Cross ReactivityHuman,Mouse,Rat
- IsotypeNA
- CloneNA
- Concentration1 mg/ml
- Form BufferLyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of PCDHAC2 antibody in PBS
- StorageStore at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.
- Shipping InfoBlue Ice
- Alternative to gene target
- [ "protocadherin alpha subfamily C, 2", "PCDHAC2 and IDBG-408710 and ENSG00000243232 and 56134", "calcium ion binding", "Plasma membranes", "Pcdhac2 and IDBG-139382 and ENSMUSG00000007440 and 116731,12936,12942,12943,192161,192164,353234,353236,353237", "PCDHGC3 and IDBG-646108 and ENSBTAG00000017349 and 100125301,521340,532241" ]
- Gene targetPCDHAC2
- Identity:HGNC:8677
- Gene:PCDHAC2
- Long gene name:protocadherin alpha subfamily C, 2
- Synonyms:PCDH-ALPHA-C2
- Discovery year:2000-06-28
- Entrez gene record:56134
- Pubmed identification:10380929
- RefSeq identity:NM_018899
- Classification:Clustered protocadherins
- VEGA ID:OTTHUMG00000129607
- Gene symbolPCDHAC2
- isotype filter
- NA
- Short nameRabbit PCDHAC2 antibody
- technique filter
- Antibody
- Rabbit
- TechniqueAntibody, Rabbit, antibodies against human proteins, antibodies for
- Alternative techniqueantibodies, rabbit-anti