gentaur logogentaur logo
x

Rabbit Pannexin 3 antibody

  • Catalog number
    70R-7072
  • Product name
    Rabbit Pannexin 3 antibody
  • Size
    50 ug
  • Applications
    WB
  • Product Type
    Primary Antibodies
  • Product Subtype
    Purified Polyclonal Antibodies
  • Research Area
    Cell Biology
  • Immunogen
    Pannexin 3 antibody was raised using the middle region of PANX3 corresponding to a region with amino acids IISELDKSYNRSIRLVQHMLKIRQKSSDPYVFWNELEKARKERYFEFPLL
  • Host
    Rabbit, Rabbits
  • Specificity
    Pannexin 3 antibody was raised against the middle region of PANX3
  • Cross Reactivity
    Human,Mouse,Rat
  • Isotype
    NA
  • Clone
    NA
  • Concentration
    1 mg/ml
  • Form Buffer
    Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of PANX3 antibody in PBS
  • Storage
    Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.
  • Shipping Info
    Blue Ice
  • Gene target
    Pannexin 3
    • Gene info
  • Gene symbol
    PANX3
  • isotype filter
    • NA
  • Short name
    Rabbit Pannexin 3 antibody
  • technique filter
    • Antibody
    • Rabbit
  • Technique
    Antibody, Rabbit, antibodies against human proteins, antibodies for
  • Alternative technique
    antibodies, rabbit-anti