- Catalog number70R-4907
- Product nameRabbit PAIP1 antibody
- Size50 ug
- PriceAsk For Price
- ApplicationsWB
- Product TypePrimary Antibodies
- Product SubtypePurified Polyclonal Antibodies
- Research AreaDNA & RNA
- ImmunogenPAIP1 antibody was raised using a synthetic peptide corresponding to a region with amino acids MSDGFDRAPEQTRPLRAPPSSQDKIPQQNSESAMAKPQVVVAPVLMSKLS
- HostRabbit, Rabbits
- SpecificityNA
- Cross ReactivityHuman,Mouse
- IsotypeNA
- CloneNA
- Concentration1 mg/ml
- Form BufferLyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of PAIP1 antibody in PBS
- StorageStore at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.
- Shipping InfoBlue Ice
- Gene targetPAIP1
- Identity:HGNC:16945
- Gene:PAIP1
- Long gene name:poly(A) binding protein interacting protein 1
- Discovery year:2003-12-16
- Entrez gene record:10605
- Pubmed identification:9548260, 11230166
- RefSeq identity:NM_006451
- VEGA ID:OTTHUMG00000096960
- Gene symbolPAIP1
- isotype filter
- NA
- Short nameRabbit PAIP1 antibody
- technique filter
- Antibody
- Rabbit
- TechniqueAntibody, Rabbit, antibodies against human proteins, antibodies for
- Alternative techniqueantibodies, rabbit-anti