- Catalog number70R-4653
- Product nameRabbit PABPC1 antibody
- Size50 ug
- PriceAsk For Price
- ApplicationsWB
- Product TypePrimary Antibodies
- Product SubtypePurified Polyclonal Antibodies
- Research AreaDNA & RNA
- ImmunogenPABPC1 antibody was raised using a synthetic peptide corresponding to a region with amino acids LRPSPRWTAQGARPHPFQNMPGAIRPAAPRPPFSTMRPASSQVPRVMSTQ
- HostRabbit, Rabbits
- SpecificityNA
- Cross ReactivityHuman,Mouse,Rat
- IsotypeNA
- CloneNA
- Concentration1 mg/ml
- Form BufferLyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of PABPC1 antibody in PBS
- StorageStore at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.
- Shipping InfoBlue Ice
- Gene targetPABPC1
- Identity:HGNC:8554
- Gene:PABPC1
- Long gene name:poly(A) binding protein cytoplasmic 1
- Synonyms gene name:poly(A)-binding protein, cytoplasmic 2
- Synonyms:PABP1PABPL1
- Discovery year:1992-09-28
- Entrez gene record:26986
- Pubmed identification:2885805
- RefSeq identity:NM_002568
- Classification:RNA binding motif containing, MicroRNA protein coding host genes
- VEGA ID:OTTHUMG00000164779
- Gene symbolPABPC1
- isotype filter
- NA
- Short nameRabbit PABPC1 antibody
- technique filter
- Antibody
- Rabbit
- TechniqueAntibody, Rabbit, antibodies against human proteins, antibodies for
- Alternative techniqueantibodies, rabbit-anti