Rabbit MYH10 antibody
-
Catalog number70R-2885
-
PricePlease ask
-
Size50 ug
-
-
ApplicationsWB
-
Product TypePrimary Antibodies
-
Product SubtypePurified Polyclonal Antibodies
-
Research AreaCell Biology
-
ImmunogenMYH10 antibody was raised using the N terminal of MYH10 corresponding to a region with amino acids WFPKATDKTFVEKLVQEQGSHSKFQKPRQLKDKADFCIIHYAGKVDYKAD
-
SpecificityMYH10 antibody was raised against the N terminal of MYH10
-
Cross ReactivityHuman,Mouse,Rat
-
CloneNA
-
Concentration1 mg/ml
-
Form BufferLyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of MYH10 antibody in PBS
-
StorageStore at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.
-
Shipping InfoBlue Ice
-
PropertiesIf you buy Antibodies supplied by fitzgerald they should be stored frozen at - 24°C for long term storage and for short term at + 5°C.
-
AboutRabbits are used for polyclonal antibody production by fitzgerald. Rabbit antibodies are very stable and can be stored for several days at room temperature. fitzgerald adds sodium azide and glycerol to enhance the stability of the rabbit polyclonal antibodies. Anti-human, anti mouse antibodies to highly immunogenic selected peptide sequences are" monoclonal like" since the epitope to which they are directed is less than 35 amino acids long.
-
Latin nameOryctolagus cuniculus
-
French translationanticorps
-
Gene target
-
Gene symbolMYH10
-
Short nameRabbit MYH10 antibody
-
TechniqueAntibody, Rabbit, antibodies against human proteins, antibodies for
-
HostRabbit, Rabbits
-
IsotypeNA
-
Alternative nameRabbit polyclonal MYH10 antibody raised against the N terminal of MYH10
-
Alternative techniqueantibodies, rabbit-anti
-
Alternative to gene targetmyosin, heavy chain 10, non-muscle, NMMHC-IIB and NMMHCB, MYH10 and IDBG-29180 and ENSG00000133026 and 4628, actin filament binding, nuclei, Myh10 and IDBG-188943 and ENSMUSG00000020900 and 77579, MYH10 and IDBG-635933 and ENSBTAG00000021151 and 317655
-
Gene info
-
Identity
-
Gene
-
Long gene namemyosin heavy chain 10
-
Synonyms gene name
- myosin, heavy polypeptide 10, non-muscle
-
Synonyms
-
GenBank acession
-
Locus
-
Discovery year1991-05-15
-
Entrez gene record
-
Pubmed identfication
-
Classification
- Myosin heavy chains, class II
-
VEGA ID
MeSH Data
-
Name
-
ConceptScope note: Identification of proteins or peptides that have been electrophoretically separated by blot transferring from the electrophoresis gel to strips of nitrocellulose paper, followed by labeling with antibody probes.
-
Tree numbers
- E05.196.401.143
- E05.301.300.096
- E05.478.566.320.200
- E05.601.262
- E05.601.470.320.200
-
Qualifiersethics, trends, veterinary, history, classification, economics, instrumentation, methods, standards, statistics & numerical data