- Catalog number70R-2885
- Product nameRabbit MYH10 antibody
- Size50 ug
- PriceAsk For Price
- ApplicationsWB
- Product TypePrimary Antibodies
- Product SubtypePurified Polyclonal Antibodies
- Research AreaCell Biology
- ImmunogenMYH10 antibody was raised using the N terminal of MYH10 corresponding to a region with amino acids WFPKATDKTFVEKLVQEQGSHSKFQKPRQLKDKADFCIIHYAGKVDYKAD
- HostRabbit, Rabbits
- SpecificityMYH10 antibody was raised against the N terminal of MYH10
- Cross ReactivityHuman,Mouse,Rat
- IsotypeNA
- CloneNA
- Concentration1 mg/ml
- Form BufferLyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of MYH10 antibody in PBS
- StorageStore at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.
- Shipping InfoBlue Ice
- Alternative to gene target
- [ "myosin, heavy chain 10, non-muscle", "NMMHC-IIB and NMMHCB", "MYH10 and IDBG-29180 and ENSG00000133026 and 4628", "actin filament binding", "nuclei", "Myh10 and IDBG-188943 and ENSMUSG00000020900 and 77579", "MYH10 and IDBG-635933 and ENSBTAG00000021151 and 317655" ]
- Gene targetMYH10
- Identity:HGNC:7568
- Gene:MYH10
- Long gene name:myosin heavy chain 10
- Synonyms gene name:myosin, heavy polypeptide 10, non-muscle
- Synonyms:NMMHCB
- Discovery year:1991-05-15
- Entrez gene record:4628
- Pubmed identification:1860190
- Classification:Myosin heavy chains, class II
- VEGA ID:OTTHUMG00000108195
- Gene symbolMYH10
- isotype filter
- NA
- Short nameRabbit MYH10 antibody
- technique filter
- Antibody
- Rabbit
- TechniqueAntibody, Rabbit, antibodies against human proteins, antibodies for
- Alternative techniqueantibodies, rabbit-anti