• Catalog number
    70R-2885
  • Product name
    Rabbit MYH10 antibody
  • Size
    50 ug
  • Applications
    WB
  • Product Type
    Primary Antibodies
  • Product Subtype
    Purified Polyclonal Antibodies
  • Research Area
    Cell Biology
  • Immunogen
    MYH10 antibody was raised using the N terminal of MYH10 corresponding to a region with amino acids WFPKATDKTFVEKLVQEQGSHSKFQKPRQLKDKADFCIIHYAGKVDYKAD
  • Host
    Rabbit, Rabbits
  • Specificity
    MYH10 antibody was raised against the N terminal of MYH10
  • Cross Reactivity
    Human,Mouse,Rat
  • Isotype
    NA
  • Clone
    NA
  • Concentration
    1 mg/ml
  • Form Buffer
    Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of MYH10 antibody in PBS
  • Storage
    Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.
  • Shipping Info
    Blue Ice
  • Alternative to gene target
    • [ "myosin, heavy chain 10, non-muscle", "NMMHC-IIB and NMMHCB", "MYH10 and IDBG-29180 and ENSG00000133026 and 4628", "actin filament binding", "nuclei", "Myh10 and IDBG-188943 and ENSMUSG00000020900 and 77579", "MYH10 and IDBG-635933 and ENSBTAG00000021151 and 317655" ]
  • Gene target
    MYH10
  • Gene info
  • Gene symbol
    MYH10
  • isotype filter
    • NA
  • Short name
    Rabbit MYH10 antibody
  • technique filter
    • Antibody
    • Rabbit
  • Technique
    Antibody, Rabbit, antibodies against human proteins, antibodies for
  • Alternative technique
    antibodies, rabbit-anti