- Catalog number70R-1861
- Product nameRabbit LRPAP1 antibody
- Size100 ug
- PriceAsk For Price
- ApplicationsWB, IHC
- Product TypePrimary Antibodies
- Product SubtypePurified Polyclonal Antibodies
- Research AreaNeuroscience
- ImmunogenLRPAP1 antibody was raised using the C terminal of LRPAP1 corresponding to a region with amino acids IDLWDLAQSANLTDKELEAFREELKHFEAKIEKHNHYQKQLEIAHEKLRH
- HostRabbit, Rabbits
- SpecificityLRPAP1 antibody was raised against the C terminal of LRPAP1
- Cross ReactivityHuman,Mouse,Rat,Dog
- IsotypeNA
- CloneNA
- Concentration1 mg/ml
- Form BufferLyophilized powder. Add 100ul distilled water for a 1mg/ml concentration of LRPAP1 antibody in PBS
- StorageStore at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.
- Shipping InfoBlue Ice
- Gene targetLRPAP1
- Identity:HGNC:6701
- Gene:LRPAP1
- Long gene name:LDL receptor related protein associated protein 1
- Synonyms gene name:low density lipoprotein-related protein-associated protein 1 (alpha-2-macroglobulin receptor-associated protein 1), low density lipoprotein receptor-related protein associated protein 1
- Synonyms:HBP44,
- Discovery year:1993-07-13
- Entrez gene record:4043
- Pubmed identification:1712782, 7538675, 7789983
- VEGA ID:OTTHUMG00000090299
- Gene symbolLRPAP1
- isotype filter
- NA
- Short nameRabbit LRPAP1 antibody
- technique filter
- Antibody
- Rabbit
- TechniqueAntibody, Rabbit, antibodies against human proteins, antibodies for
- Alternative techniqueantibodies, rabbit-anti
Gene info
Locus Specific Databases:LRG_1299