- Catalog number70R-7207
- Product nameRabbit LCAT antibody
- Size50 ug
- PriceAsk For Price
- ApplicationsWB
- Product TypePrimary Antibodies
- Product SubtypePurified Polyclonal Antibodies
- Research AreaProteases, Inhibitors, & Enzymes
- ImmunogenLCAT antibody was raised using the C terminal of LCAT corresponding to a region with amino acids GVLYEDGDDTVATRSTELCGLWQGRQPQPVHLLPLHGIQHLNMVFSNLTL
- HostRabbit, Rabbits
- SpecificityLCAT antibody was raised against the C terminal of LCAT
- Cross ReactivityHuman,Mouse,Rat
- IsotypeNA
- CloneNA
- Concentration1 mg/ml
- Form BufferLyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of LCAT antibody in PBS
- StorageStore at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.
- Shipping InfoBlue Ice
- Gene targetLCAT
- Identity:HGNC:6522
- Gene:LCAT
- Long gene name:lecithin-cholesterol acyltransferase
- Discovery year:2001-06-22
- Entrez gene record:3931
- VEGA ID:OTTHUMG00000137551
- Gene symbolLCAT
- isotype filter
- NA
- Short nameRabbit LCAT antibody
- technique filter
- Antibody
- Rabbit
- TechniqueAntibody, Rabbit, antibodies against human proteins, antibodies for
- Alternative techniqueantibodies, rabbit-anti