- Catalog number70R-5906
- Product nameRabbit LBP antibody
- Size50 ug
- PriceAsk For Price
- ApplicationsWB
- Product TypePrimary Antibodies
- Product SubtypePurified Polyclonal Antibodies
- Research AreaImmunology
- ImmunogenLBP antibody was raised using the C terminal of LBP corresponding to a region with amino acids FLKPGKVKVELKESKVGLFNAELLEALLNYYILNTFYPKFNDKLAEGFPL
- HostRabbit, Rabbits
- SpecificityLBP antibody was raised against the C terminal of LBP
- Cross ReactivityHuman
- IsotypeNA
- CloneNA
- Concentration1 mg/ml
- Form BufferLyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of LBP antibody in PBS
- StorageStore at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.
- Shipping InfoBlue Ice
- Alternative to gene target
- [ "lipopolysaccharide binding protein", "BPIFD2", "LBP and IDBG-74721 and ENSG00000129988 and 3929", "lipoteichoic acid binding", "Extracellular", "Lbp and IDBG-211482 and ENSMUSG00000016024 and 16803", "BT.24181 and IDBG-642596 and ENSBTAG00000016864 and 512242" ]
- Gene targetLBP
- Identity:HGNC:6517
- Gene:LBP
- Long gene name:lipopolysaccharide binding protein
- Synonyms gene name:lipopolysaccharide-binding protein
- Synonyms:BPIFD2
- Discovery year:1992-03-13
- Entrez gene record:3929
- Pubmed identification:8432532
- RefSeq identity:NM_004139
- Classification:BPI fold containing
- VEGA ID:OTTHUMG00000032447
- Identity:HGNC:17925
- Gene:TFCP2L1
- Long gene name:transcription factor CP2 like 1
- Synonyms gene name:transcription factor CP2-like 1
- Synonyms:LBP-9CRTR1
- Discovery year:2004-01-05
- Entrez gene record:29842
- Pubmed identification:10644752, 11073954
- RefSeq identity:NM_014553
- VEGA ID:OTTHUMG00000131443
- Identity:HGNC:12507
- Gene:UBP1
- Long gene name:upstream binding protein 1
- Synonyms:LBP-1a
- Discovery year:1996-05-13
- Entrez gene record:7342
- Pubmed identification:8114710
- RefSeq identity:NM_014517
- VEGA ID:OTTHUMG00000130749
- Identity:HGNC:17923
- Gene:GRHL1
- Long gene name:grainyhead like transcription factor 1
- Synonyms gene name:transcription factor CP2-like 2, grainyhead-like 1 (Drosophila)
- Synonyms:LBP-32, MGR
- Discovery year:2004-01-05
- Entrez gene record:29841
- Pubmed identification:10644752, 12393799, 12175488
- RefSeq identity:NM_014552
- VEGA ID:OTTHUMG00000151704
- Identity:HGNC:11748
- Gene:TFCP2
- Long gene name:transcription factor CP2
- Synonyms:CP2LSFLBP-1CTFCP2C
- Discovery year:1994-12-15
- Entrez gene record:7024
- Pubmed identification:8157699
- RefSeq identity:NM_005653
- VEGA ID:OTTHUMG00000169621
- Gene symbolLBP, TFCP2L1, UBP1, GRHL1, TFCP2
- isotype filter
- NA
- Short nameRabbit LBP antibody
- technique filter
- Antibody
- Rabbit
- TechniqueAntibody, Rabbit, antibodies against human proteins, antibodies for
- Alternative techniqueantibodies, rabbit-anti