- Catalog number70R-5694
- Product nameRabbit IL1 beta antibody
- Size50 ug
- PriceAsk For Price
- ApplicationsWB
- Product TypePrimary Antibodies
- Product SubtypePurified Polyclonal Antibodies
- Research AreaCytokines & Growth Factors
- ImmunogenIL1 beta antibody was raised using the N terminal of IL1B corresponding to a region with amino acids MAEVPELASEMMAYYSGNEDDLFFEADGPKQMKCSFQDLDLCPLDGGIQL
- HostRabbit, Rabbits
- SpecificityIL1 beta antibody was raised against the N terminal of IL1B
- Cross ReactivityHuman
- IsotypeNA
- CloneNA
- Concentration1 mg/ml
- Form BufferLyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of IL1B antibody in PBS
- StorageStore at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.
- Shipping InfoBlue Ice
- Gene targetIL1 beta
- Identity:HGNC:15562
- Gene:IL36A
- Long gene name:interleukin 36 alpha
- Synonyms gene name:interleukin 1 family, member 6 (epsilon)
- Synonyms:FIL1FIL1EIL-1F6IL1(EPSILON)MGC129553MGC129552
- Discovery year:2002-08-02
- Entrez gene record:27179
- Pubmed identification:10625660
- RefSeq identity:NM_014440
- Classification:Interleukins
- VEGA ID:OTTHUMG00000153320
- Identity:HGNC:15552
- Gene:IL1F10
- Long gene name:interleukin 1 family member 10
- Synonyms gene name:interleukin 1 family, member 10 (theta)
- Synonyms:FKSG75IL-1HY2IL-1F10IL1-thetaMGC11983MGC119832MGC119833
- Discovery year:2002-08-02
- Entrez gene record:84639
- Pubmed identification:11747621, 11991723, 11991722
- RefSeq identity:NM_173161
- Classification:Interleukins
- VEGA ID:OTTHUMG00000131339
- Identity:HGNC:15564
- Gene:IL36B
- Long gene name:interleukin 36 beta
- Synonyms gene name:interleukin 1 family, member 8 (eta)
- Synonyms:FIL1IL-1H2IL-1F8FILI-(ETA)IL1-ETAIL1H2MGC126880MGC126882
- Discovery year:2002-08-02
- Entrez gene record:27177
- Pubmed identification:10625660, 10512743, 16646978
- RefSeq identity:NM_014438
- Classification:Interleukins
- VEGA ID:OTTHUMG00000131338
- Gene symbolIL1A, IL1B, IL36A, IL1F10, IL36B
- isotype filter
- NA
- Short nameRabbit IL1 beta antibody
- technique filter
- Antibody
- Rabbit
- TechniqueAntibody, Rabbit, antibodies against human proteins, antibodies for
- Alternative techniqueantibodies, rabbit-anti