• Catalog number
    70R-1458
  • Product name
    Rabbit HNRPLL antibody
  • Size
    100 ug
  • Applications
    WB, IHC
  • Product Type
    Primary Antibodies
  • Product Subtype
    Purified Polyclonal Antibodies
  • Research Area
    DNA & RNA
  • Immunogen
    HNRPLL antibody was raised using the N terminal of HNRPLL corresponding to a region with amino acids RLKTEEGEIDYSAEEGENRREATPRGGGDGGGGGRSFSQPEAGGSHHKVS
  • Host
    Rabbit, Rabbits
  • Specificity
    HNRPLL antibody was raised against the N terminal of HNRPLL
  • Cross Reactivity
    Human,Dog
  • Isotype
    NA
  • Clone
    NA
  • Concentration
    1 mg/ml
  • Form Buffer
    Lyophilized powder. Add 100ul distilled water for a 1mg/ml concentration of HNRPLL antibody in PBS
  • Storage
    Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.
  • Shipping Info
    Blue Ice
  • Gene target
    HNRPLL
  • Gene info
    • Identity:HGNC:25127
    • Gene:HNRNPLL
    • Long gene name:heterogeneous nuclear ribonucleoprotein L like
    • Discovery year:2004-11-30
    • Entrez gene record:92906
    • Pubmed identification:18669861
    • RefSeq identity:NM_138394
    • Classification:Heterogeneous nuclear ribonucleoproteins, RNA binding motif containing
    • VEGA ID:OTTHUMG00000102075
  • Gene symbol
    HNRNPLL
  • isotype filter
    • NA
  • Short name
    Rabbit HNRPLL antibody
  • technique filter
    • Antibody
    • Rabbit
  • Technique
    Antibody, Rabbit, antibodies against human proteins, antibodies for
  • Alternative technique
    antibodies, rabbit-anti