- Catalog number70R-1458
- Product nameRabbit HNRPLL antibody
- Size100 ug
- PriceAsk For Price
- ApplicationsWB, IHC
- Product TypePrimary Antibodies
- Product SubtypePurified Polyclonal Antibodies
- Research AreaDNA & RNA
- ImmunogenHNRPLL antibody was raised using the N terminal of HNRPLL corresponding to a region with amino acids RLKTEEGEIDYSAEEGENRREATPRGGGDGGGGGRSFSQPEAGGSHHKVS
- HostRabbit, Rabbits
- SpecificityHNRPLL antibody was raised against the N terminal of HNRPLL
- Cross ReactivityHuman,Dog
- IsotypeNA
- CloneNA
- Concentration1 mg/ml
- Form BufferLyophilized powder. Add 100ul distilled water for a 1mg/ml concentration of HNRPLL antibody in PBS
- StorageStore at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.
- Shipping InfoBlue Ice
- Gene targetHNRPLL
- Identity:HGNC:25127
- Gene:HNRNPLL
- Long gene name:heterogeneous nuclear ribonucleoprotein L like
- Discovery year:2004-11-30
- Entrez gene record:92906
- Pubmed identification:18669861
- RefSeq identity:NM_138394
- Classification:Heterogeneous nuclear ribonucleoproteins, RNA binding motif containing
- VEGA ID:OTTHUMG00000102075
- Gene symbolHNRNPLL
- isotype filter
- NA
- Short nameRabbit HNRPLL antibody
- technique filter
- Antibody
- Rabbit
- TechniqueAntibody, Rabbit, antibodies against human proteins, antibodies for
- Alternative techniqueantibodies, rabbit-anti