- Catalog number70R-2852
- Product nameRabbit GSTM5 antibody
- Size50 ug
- PriceAsk For Price
- ApplicationsWB
- Product TypePrimary Antibodies
- Product SubtypePurified Polyclonal Antibodies
- Research AreaProteases, Inhibitors, & Enzymes
- ImmunogenGSTM5 antibody was raised using the N terminal of GSTM5 corresponding to a region with amino acids MPMTLGYWDIRGLAHAIRLLLEYTDSSYVEKKYTLGDAPDYDRSQWLNEK
- HostRabbit, Rabbits
- SpecificityGSTM5 antibody was raised against the N terminal of GSTM5
- Cross ReactivityHuman
- IsotypeNA
- CloneNA
- Concentration1 mg/ml
- Form BufferLyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of GSTM5 antibody in PBS
- StorageStore at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.
- Shipping InfoBlue Ice
- Gene targetGSTM5
- Identity:HGNC:4637
- Gene:GSTM5
- Long gene name:glutathione S-transferase mu 5
- Synonyms gene name:glutathione S-transferase M5
- Discovery year:1993-06-15
- Entrez gene record:2949
- Pubmed identification:8473333
- RefSeq identity:NM_000851
- Classification:Soluble glutathione S-transferases
- VEGA ID:OTTHUMG00000011644
- Gene symbolGSTM5
- isotype filter
- NA
- Short nameRabbit GSTM5 antibody
- technique filter
- Antibody
- Rabbit
- TechniqueAntibody, Rabbit, antibodies against human proteins, antibodies for
- Alternative techniqueantibodies, rabbit-anti