- Catalog number70R-1204
- Product nameRabbit GMPPB antibody
- Size100 ug
- PriceAsk For Price
- ApplicationsWB, IHC
- Product TypePrimary Antibodies
- Product SubtypePurified Polyclonal Antibodies
- Research AreaCell Biology
- ImmunogenGMPPB antibody was raised using the C terminal of GMPPB corresponding to a region with amino acids RCRVGQWVRMENVTVLGEDVIVNDELYLNGASVLPHKSIGESVPEPRIIM
- HostRabbit, Rabbits
- SpecificityGMPPB antibody was raised against the C terminal of GMPPB
- Cross ReactivityHuman,Mouse,Rat
- IsotypeNA
- CloneNA
- Concentration1 mg/ml
- Form BufferLyophilized powder. Add 100ul distilled water for a 1mg/ml concentration of GMPPB antibody in PBS
- StorageStore at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.
- Shipping InfoBlue Ice
- Gene targetGMPPB
- Identity:HGNC:22932
- Gene:GMPPB
- Long gene name:GDP-mannose pyrophosphorylase B
- Synonyms:KIAA1851
- Discovery year:2005-01-10
- Entrez gene record:29925
- RefSeq identity:NM_013334
- VEGA ID:OTTHUMG00000158151
- Gene symbolGMPPB
- isotype filter
- NA
- Short nameRabbit GMPPB antibody
- technique filter
- Antibody
- Rabbit
- TechniqueAntibody, Rabbit, antibodies against human proteins, antibodies for
- Alternative techniqueantibodies, rabbit-anti