- Catalog number70R-5908
- Product nameRabbit CFP antibody
- Size50 ug
- PriceAsk For Price
- ApplicationsWB
- Product TypePrimary Antibodies
- Product SubtypePurified Polyclonal Antibodies
- Research AreaSignal Transduction
- ImmunogenCFP antibody was raised using the N terminal of CFP corresponding to a region with amino acids QYEESSGKCKGLLGGGVSVEDCCLNTAFAYQKRSGGLCQPCRSPRWSLWS
- HostRabbit, Rabbits
- SpecificityCFP antibody was raised against the N terminal of CFP
- Cross ReactivityHuman
- IsotypeNA
- CloneNA
- Concentration1 mg/ml
- Form BufferLyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of CFP antibody in PBS
- StorageStore at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.
- Shipping InfoBlue Ice
- Alternative to gene target
- [ "complement factor properdin", "BFD and PFC and PFD and PROPERDIN", "CFP and IDBG-61793 and ENSG00000126759 and 5199", "Extracellular", "Cfp and IDBG-135734 and ENSMUSG00000001128 and 18636", "CFP and IDBG-636742 and ENSBTAG00000015815 and 539605" ]
- Gene targetCFP
- Identity:HGNC:8864
- Gene:CFP
- Long gene name:complement factor properdin
- Synonyms gene name:properdin P factor, complement
- Discovery year:1989-06-07
- Entrez gene record:5199
- Pubmed identification:1783405
- RefSeq identity:NM_002621
- Classification:Complement system activation components
- VEGA ID:OTTHUMG00000021451
- Gene symbolCFP
- isotype filter
- NA
- Short nameRabbit CFP antibody
- technique filter
- Antibody
- Rabbit
- TechniqueAntibody, Rabbit, antibodies against human proteins, antibodies for
- Alternative techniqueantibodies, rabbit-anti
Gene info
Locus Specific Databases:PFCbase: Mutation registry for properdin deficiencyGlobal Variome shared LOVDLRG_129