- Catalog number70R-1509
- Product nameRabbit CACNB2 antibody
- Size100 ug
- PriceAsk For Price
- ApplicationsWB
- Product TypePrimary Antibodies
- Product SubtypePurified Polyclonal Antibodies
- Research AreaSignal Transduction
- ImmunogenCACNB2 antibody was raised using the C terminal of CACNB2 corresponding to a region with amino acids APHHNHRSGTSRGLSRQETFDSETQESRDSAYVEPKEDYSHDHVDHYASH
- HostRabbit, Rabbits
- SpecificityCACNB2 antibody was raised against the C terminal of CACNB2
- Cross ReactivityHuman,Mouse,Rat,Dog
- IsotypeNA
- CloneNA
- Concentration1 mg/ml
- Form BufferLyophilized powder. Add 100ul distilled water for a 1mg/ml concentration of CACNB2 antibody in PBS
- StorageStore at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.
- Shipping InfoBlue Ice
- Gene targetCACNB2
- Identity:HGNC:1402
- Gene:CACNB2
- Long gene name:calcium voltage-gated channel auxiliary subunit beta 2
- Synonyms gene name:calcium channel, voltage-dependent, beta 2 subunit
- Discovery year:1992-03-27
- Entrez gene record:783
- Pubmed identification:9254841, 8494331
- RefSeq identity:NM_000724
- Classification:Membrane associated guanylate kinases, Calcium voltage-gated channel auxiliary beta subunits
- VEGA ID:OTTHUMG00000017764
- Gene symbolCACNB2
- isotype filter
- NA
- Short nameRabbit CACNB2 antibody
- technique filter
- Antibody
- Rabbit
- TechniqueAntibody, Rabbit, antibodies against human proteins, antibodies for
- Alternative techniqueantibodies, rabbit-anti
Gene info
Locus Specific Databases:LRG_381