gentaur logogentaur logo
x

Rabbit BVES antibody

  • Catalog number
    70R-6558
  • Product name
    Rabbit BVES antibody
  • Size
    50 ug
  • Applications
    WB
  • Product Type
    Primary Antibodies
  • Product Subtype
    Purified Polyclonal Antibodies
  • Research Area
    Cell Biology
  • Immunogen
    BVES antibody was raised using the middle region of BVES corresponding to a region with amino acids  YLIGKDITNKLYSLNDPTLNDKKAKKLEHQLSLCTQISMLEMRNSIASSS
  • Host
    Rabbit, Rabbits
  • Specificity
    BVES antibody was raised against the middle region of BVES
  • Cross Reactivity
    Human
  • Isotype
    NA
  • Clone
    NA
  • Concentration
    1 mg/ml
  • Form Buffer
    Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of BVES antibody in PBS
  • Storage
    Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.
  • Shipping Info
    Blue Ice
  • Alternative to gene target
    • [ "blood vessel epicardial substance", "HBVES and POP1 and POPDC1", "BVES and IDBG-94774 and ENSG00000112276 and 11149", "cAMP binding", "Cell surfaces", "Bves and IDBG-148896 and ENSMUSG00000071317 and 23828", "BVES and IDBG-631953 and ENSBTAG00000018790 and 539988" ]
  • Gene target
    BVES
    • Gene info
    Gene info
  • Gene symbol
    BVES, BVES-AS1
  • isotype filter
    • NA
  • Short name
    Rabbit BVES antibody
  • technique filter
    • Antibody
    • Rabbit
  • Technique
    Antibody, Rabbit, antibodies against human proteins, antibodies for
  • Alternative technique
    antibodies, rabbit-anti