Rabbit BECN1 antibody
-
Catalog number70R-5935
-
PricePlease ask
-
Size50 ug
-
-
ApplicationsWB
-
Product TypePrimary Antibodies
-
Product SubtypePurified Polyclonal Antibodies
-
Research AreaCell Biology
-
ImmunogenBECN1 antibody was raised using the N terminal of BECN1 corresponding to a region with amino acids MVRMVPVLLSLLLLLGPAVPQENQDGRYSLTYIYTGLSKHVEDVPAFQAL
-
SpecificityBECN1 antibody was raised against the N terminal of BECN1
-
Cross ReactivityHuman
-
CloneNA
-
Concentration1 mg/ml
-
Form BufferLyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of BECN1 antibody in PBS
-
StorageStore at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.
-
Shipping InfoBlue Ice
-
PropertiesIf you buy Antibodies supplied by fitzgerald they should be stored frozen at - 24°C for long term storage and for short term at + 5°C.
-
AboutRabbits are used for polyclonal antibody production by fitzgerald. Rabbit antibodies are very stable and can be stored for several days at room temperature. fitzgerald adds sodium azide and glycerol to enhance the stability of the rabbit polyclonal antibodies. Anti-human, anti mouse antibodies to highly immunogenic selected peptide sequences are" monoclonal like" since the epitope to which they are directed is less than 35 amino acids long.
-
Latin nameOryctolagus cuniculus
-
French translationanticorps
-
Gene target
-
Gene symbolBECN1
-
Short nameRabbit BECN1 antibody
-
TechniqueAntibody, Rabbit, antibodies against human proteins, antibodies for
-
HostRabbit, Rabbits
-
IsotypeNA
-
Alternative nameRabbit polyclonal BECN1 antibody raised against the N terminal of BECN1
-
Alternative techniqueantibodies, rabbit-anti
-
Alternative to gene targetbeclin 1, autophagy related, ATG6 and beclin1 and VPS30, BECN1 and IDBG-51769 and ENSG00000126581 and 102725513,8678, sequence-specific DNA binding, Plasma membranes, Becn1 and IDBG-212053 and ENSMUSG00000035086 and 56208, BECN1 and IDBG-640456 and ENSBTAG00000019914 and 527278
-
Gene info
-
Identity
-
Gene
-
Long gene namebeclin 1
-
Synonyms gene name
- beclin 1 (coiled-coil, moesin-like BCL2 interacting protein)
- beclin 1, autophagy related
-
Synonyms
-
Synonyms name
-
GenBank acession
-
Locus
-
Discovery year1998-11-27
-
Entrez gene record
-
Pubmed identfication
-
RefSeq identity
-
Classification
- PIK3C3 complex subunits
- MicroRNA protein coding host genes
- Autophagy related
-
VEGA ID
MeSH Data
-
Name
-
ConceptScope note: Identification of proteins or peptides that have been electrophoretically separated by blot transferring from the electrophoresis gel to strips of nitrocellulose paper, followed by labeling with antibody probes.
-
Tree numbers
- E05.196.401.143
- E05.301.300.096
- E05.478.566.320.200
- E05.601.262
- E05.601.470.320.200
-
Qualifiersethics, trends, veterinary, history, classification, economics, instrumentation, methods, standards, statistics & numerical data