- Catalog number70R-5935
- Product nameRabbit BECN1 antibody
- Size50 ug
- PriceAsk For Price
- ApplicationsWB
- Product TypePrimary Antibodies
- Product SubtypePurified Polyclonal Antibodies
- Research AreaCell Biology
- ImmunogenBECN1 antibody was raised using the N terminal of BECN1 corresponding to a region with amino acids MVRMVPVLLSLLLLLGPAVPQENQDGRYSLTYIYTGLSKHVEDVPAFQAL
- HostRabbit, Rabbits
- SpecificityBECN1 antibody was raised against the N terminal of BECN1
- Cross ReactivityHuman
- IsotypeNA
- CloneNA
- Concentration1 mg/ml
- Form BufferLyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of BECN1 antibody in PBS
- StorageStore at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.
- Shipping InfoBlue Ice
- Alternative to gene target
- [ "beclin 1, autophagy related", "ATG6 and beclin1 and VPS30", "BECN1 and IDBG-51769 and ENSG00000126581 and 102725513,8678", "sequence-specific DNA binding", "Plasma membranes", "Becn1 and IDBG-212053 and ENSMUSG00000035086 and 56208", "BECN1 and IDBG-640456 and ENSBTAG00000019914 and 527278" ]
- Gene targetBECN1
- Identity:HGNC:1034
- Gene:BECN1
- Long gene name:beclin 1
- Synonyms gene name:beclin 1 (coiled-coil, moesin-like BCL2 interacting protein), beclin 1, autophagy related
- Synonyms:ATG6, VPS30
- Discovery year:1998-11-27
- Entrez gene record:8678
- Pubmed identification:9765397
- RefSeq identity:NM_003766
- Classification:PIK3C3 complex subunits, MicroRNA protein coding host genes, Autophagy related
- VEGA ID:OTTHUMG00000180653
- Gene symbolBECN1
- isotype filter
- NA
- Short nameRabbit BECN1 antibody
- technique filter
- Antibody
- Rabbit
- TechniqueAntibody, Rabbit, antibodies against human proteins, antibodies for
- Alternative techniqueantibodies, rabbit-anti