- Catalog number70R-4818
- Product nameRabbit AUH antibody
- Size50 ug
- PriceAsk For Price
- ApplicationsWB, IHC
- Product TypePrimary Antibodies
- Product SubtypePurified Polyclonal Antibodies
- Research AreaDNA & RNA
- ImmunogenAUH antibody was raised using the C terminal of AUH corresponding to a region with amino acids IGMSLAKELIFSARVLDGKEAKAVGLISHVLEQNQEGDAAYRKALDLARE
- HostRabbit, Rabbits
- SpecificityAUH antibody was raised against the C terminal of AUH
- Cross ReactivityHuman,Mouse,Rat,Dog
- IsotypeNA
- CloneNA
- Concentration1 mg/ml
- Form BufferLyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of AUH antibody in PBS
- StorageStore at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.
- Shipping InfoBlue Ice
- Gene targetAUH
- Identity:HGNC:890
- Gene:AUH
- Long gene name:AU RNA binding methylglutaconyl-CoA hydratase
- Synonyms gene name:AU RNA-binding protein/enoyl-Coenzyme A hydratase, AU RNA binding protein/enoyl-Coenzyme A hydratase, AU RNA binding protein/enoyl-CoA hydratase
- Discovery year:1995-10-02
- Entrez gene record:549
- Pubmed identification:7892223, 24598254
- VEGA ID:OTTHUMG00000020207
- Gene symbolAUH
- isotype filter
- NA
- Short nameRabbit AUH antibody
- technique filter
- Antibody
- Rabbit
- TechniqueAntibody, Rabbit, antibodies against human proteins, antibodies for
- Alternative techniqueantibodies, rabbit-anti
Gene info
Locus Specific Databases:LRG_449