- Catalog number70R-2865
- Product nameRabbit ATG4A antibody
- Size50 ug
- PriceAsk For Price
- ApplicationsWB
- Product TypePrimary Antibodies
- Product SubtypePurified Polyclonal Antibodies
- Research AreaCell Biology
- ImmunogenATG4A antibody was raised using a synthetic peptide corresponding to a region with amino acids PQSLGALGGKPNNAYYFIGFLGDELIFLDPHTTQTFVDTEENGTVNDQTF
- HostRabbit, Rabbits
- SpecificityNA
- Cross ReactivityHuman
- IsotypeNA
- CloneNA
- Concentration1 mg/ml
- Form BufferLyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of ATG4A antibody in PBS
- StorageStore at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.
- Shipping InfoBlue Ice
- Gene targetATG4A
- Identity:HGNC:16489
- Gene:ATG4A
- Long gene name:autophagy related 4A cysteine peptidase
- Synonyms gene name:AUT-like 2, cysteine endopeptidase (S. cerevisiae), APG4 autophagy 4 homolog A (S. cerevisiae), ATG4 autophagy related 4 homolog A (S. cerevisiae), autophagy related 4A, cysteine peptidase
- Discovery year:2001-12-05
- Entrez gene record:115201
- Pubmed identification:12446702, 12473658
- RefSeq identity:NM_052936
- Classification:Autophagy related
- VEGA ID:OTTHUMG00000022176
- Gene symbolATG4A
- isotype filter
- NA
- Short nameRabbit ATG4A antibody
- technique filter
- Antibody
- Rabbit
- TechniqueAntibody, Rabbit, antibodies against human proteins, antibodies for
- Alternative techniqueantibodies, rabbit-anti